BLASTX nr result
ID: Cheilocostus21_contig00036113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00036113 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020276319.1| uncharacterized protein LOC109850674 [Aspara... 53 5e-06 >ref|XP_020276319.1| uncharacterized protein LOC109850674 [Asparagus officinalis] gb|ONK62994.1| uncharacterized protein A4U43_C07F10290 [Asparagus officinalis] Length = 141 Score = 53.1 bits (126), Expect = 5e-06 Identities = 38/97 (39%), Positives = 50/97 (51%), Gaps = 6/97 (6%) Frame = -1 Query: 373 VKQLLLAPIRRPEAIEGQRTRRKKQSRXXXXXXPLGYSY*FDSSSKGC----CL--PIGA 212 VK L++ P+ + E + ++ RR + P YS F KGC C P Sbjct: 52 VKNLVMRPLIKFEKVCTRKKRRPPPA-------PFPYSEDF---GKGCHPHLCFVQPRVD 101 Query: 211 HHPPGDPRPAKKFSNYHLFLRSIIEKNDFFSKECNVH 101 PP P P +K S+YH FLR+ IE NDF+S ECNVH Sbjct: 102 DSPPLRPNPDRKTSSYHDFLRNFIESNDFYSPECNVH 138