BLASTX nr result
ID: Cheilocostus21_contig00036109
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00036109 (612 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009417297.1| PREDICTED: UBP1-associated protein 2C [Musa ... 65 3e-19 ref|XP_010943535.1| PREDICTED: UBP1-associated protein 2C [Elaei... 52 7e-13 ref|XP_008777247.1| PREDICTED: UBP1-associated protein 2C-like [... 50 9e-12 >ref|XP_009417297.1| PREDICTED: UBP1-associated protein 2C [Musa acuminata subsp. malaccensis] Length = 335 Score = 64.7 bits (156), Expect(2) = 3e-19 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = +2 Query: 2 VPITIPVQVGYAQPGNTQVDSPATVSYASYPPSI--YPTAYPNA 127 VPITIPV VGYAQ G Q+ S ATV YASYPP++ YP AYPNA Sbjct: 251 VPITIPVPVGYAQTGKAQIGSSATVGYASYPPALAAYPVAYPNA 294 Score = 58.5 bits (140), Expect(2) = 3e-19 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = +1 Query: 133 YTTAQHISYPLTGKMEPLGLPAVASAGITGYPYYVIKP 246 Y TA +SYP T K E +GLPAVAS GITG+PYYV KP Sbjct: 298 YPTAPQVSYPQTAKRESVGLPAVASTGITGFPYYVTKP 335 >ref|XP_010943535.1| PREDICTED: UBP1-associated protein 2C [Elaeis guineensis] ref|XP_019701598.1| PREDICTED: UBP1-associated protein 2C [Elaeis guineensis] Length = 335 Score = 52.0 bits (123), Expect(2) = 7e-13 Identities = 24/44 (54%), Positives = 30/44 (68%), Gaps = 2/44 (4%) Frame = +2 Query: 2 VPITIPVQVGYAQPGNTQVDSPATVSYASYPPSI--YPTAYPNA 127 V + +P GYAQ G +Q SP+ V YA YPP++ YPTAYPNA Sbjct: 250 VSMAVPFPAGYAQSGKSQSASPSPVGYAPYPPAMAAYPTAYPNA 293 Score = 49.7 bits (117), Expect(2) = 7e-13 Identities = 23/39 (58%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +1 Query: 133 YTTAQHISYP-LTGKMEPLGLPAVASAGITGYPYYVIKP 246 Y + ISYP + GK EP+GLP+ A AGI GYPYY KP Sbjct: 297 YASPPQISYPQVGGKKEPVGLPSAAPAGIPGYPYYATKP 335 >ref|XP_008777247.1| PREDICTED: UBP1-associated protein 2C-like [Phoenix dactylifera] Length = 335 Score = 50.1 bits (118), Expect(2) = 9e-12 Identities = 24/44 (54%), Positives = 29/44 (65%), Gaps = 2/44 (4%) Frame = +2 Query: 2 VPITIPVQVGYAQPGNTQVDSPATVSYASYPP--SIYPTAYPNA 127 VP+ +P G+AQ G +Q SP+ V YA Y P S YPTAYPNA Sbjct: 250 VPMAVPFPAGFAQSGKSQSASPSPVGYAPYLPAMSAYPTAYPNA 293 Score = 47.8 bits (112), Expect(2) = 9e-12 Identities = 22/39 (56%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +1 Query: 133 YTTAQHISYP-LTGKMEPLGLPAVASAGITGYPYYVIKP 246 Y + ISYP + GK EP+GLP+ A GI GYPYY KP Sbjct: 297 YASPPQISYPQVGGKKEPVGLPSAAPPGIPGYPYYATKP 335