BLASTX nr result
ID: Cheilocostus21_contig00036107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00036107 (677 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018681757.1| PREDICTED: uncharacterized protein LOC108952... 56 1e-06 >ref|XP_018681757.1| PREDICTED: uncharacterized protein LOC108952863 [Musa acuminata subsp. malaccensis] Length = 106 Score = 55.8 bits (133), Expect = 1e-06 Identities = 37/83 (44%), Positives = 51/83 (61%), Gaps = 5/83 (6%) Frame = -1 Query: 524 GYEMELPAAPRSQITSCLHLKLDADA----ADRGSLDKDVVLRRIRRQKRAHQLQLQA-V 360 G E +LPA S +TSCL+LK D++ A+R LD+DVVLRRIR +KR +Q++ Sbjct: 23 GDENQLPAGG-SPVTSCLYLKPDSEGSGGGAERKPLDRDVVLRRIRHRKRVNQIRTALHS 81 Query: 359 LRRSEPAVNVDSEGDRRNGWLQN 291 LR EP V+ D E + WL + Sbjct: 82 LRELEPGVDKDGE---PHAWLDD 101