BLASTX nr result
ID: Cheilocostus21_contig00036085
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00036085 (1660 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009384052.1| PREDICTED: OTU domain-containing protein DDB... 56 4e-08 >ref|XP_009384052.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Musa acuminata subsp. malaccensis] ref|XP_009384060.1| PREDICTED: OTU domain-containing protein DDB_G0284757 [Musa acuminata subsp. malaccensis] Length = 342 Score = 55.8 bits (133), Expect(2) = 4e-08 Identities = 25/37 (67%), Positives = 26/37 (70%) Frame = +2 Query: 1391 GFRLSSYDLFSISPYCGGTIQSDSSFYANGYVGEGDI 1501 GF DLFS+ PYCGGT Q DSSFY YVGEGDI Sbjct: 14 GFDFLHCDLFSVPPYCGGTSQQDSSFYDTSYVGEGDI 50 Score = 32.3 bits (72), Expect(2) = 4e-08 Identities = 21/31 (67%), Positives = 23/31 (74%), Gaps = 2/31 (6%) Frame = +1 Query: 1567 HALQE-LSQPTVAEASGSA-CEEKCLLESVL 1653 HALQE LSQ VAEASGS E++CL SVL Sbjct: 65 HALQEELSQLAVAEASGSTHAEDECLQVSVL 95