BLASTX nr result
ID: Cheilocostus21_contig00035941
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00035941 (495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN36906.1| unknown [Zea mays] 81 5e-17 ref|XP_018680744.1| PREDICTED: nuclear pore complex protein GP21... 87 1e-16 ref|XP_018680741.1| PREDICTED: nuclear pore complex protein GP21... 87 1e-16 ref|XP_020689985.1| nuclear pore complex protein GP210-like [Den... 84 2e-16 gb|PKU71647.1| hypothetical protein MA16_Dca004489 [Dendrobium c... 84 3e-16 ref|XP_020590904.1| LOW QUALITY PROTEIN: nuclear pore complex pr... 84 8e-16 gb|KQL23585.1| hypothetical protein SETIT_028644mg [Setaria ital... 83 2e-15 ref|XP_004956191.1| nuclear pore complex protein GP210 isoform X... 83 2e-15 ref|XP_004956190.1| nuclear pore complex protein GP210 isoform X... 83 2e-15 ref|XP_020155673.1| nuclear pore complex protein GP210 isoform X... 83 3e-15 ref|XP_020155672.1| nuclear pore complex protein GP210 isoform X... 83 3e-15 gb|PAN10950.1| hypothetical protein PAHAL_B01763 [Panicum hallii] 82 4e-15 gb|OEL31953.1| Nuclear pore complex protein GP210 [Dichanthelium... 82 7e-15 gb|ONM20896.1| Nuclear pore complex protein GP210 [Zea mays] 81 8e-15 ref|XP_006660990.2| PREDICTED: nuclear pore complex protein GP21... 81 1e-14 ref|NP_001335988.1| uncharacterized protein LOC100384390 [Zea mays] 81 1e-14 ref|XP_015696742.1| PREDICTED: nuclear pore complex protein GP21... 81 1e-14 ref|XP_015866211.1| PREDICTED: nuclear pore complex protein GP21... 81 1e-14 ref|XP_022740411.1| nuclear pore complex protein GP210 isoform X... 80 2e-14 ref|XP_022740410.1| nuclear pore complex protein GP210 isoform X... 80 2e-14 >gb|ACN36906.1| unknown [Zea mays] Length = 94 Score = 81.3 bits (199), Expect = 5e-17 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 4/62 (6%) Frame = -3 Query: 490 ASTPS--PIRRPATADSPSG--NVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQY 323 ASTP+ P PA P+ N QFSPRTPQP M+YVRRTID+TPYYKRD RRRF+PQ Sbjct: 33 ASTPARAPAADPAAMADPASPANGQFSPRTPQPFMEYVRRTIDDTPYYKRDARRRFNPQN 92 Query: 322 TY 317 TY Sbjct: 93 TY 94 >ref|XP_018680744.1| PREDICTED: nuclear pore complex protein GP210 isoform X2 [Musa acuminata subsp. malaccensis] Length = 1957 Score = 86.7 bits (213), Expect = 1e-16 Identities = 41/57 (71%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = -3 Query: 484 TPSPIRRPATADSPS-GNVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYTY 317 T S + P T DS S GN Q SPRTPQP M+YVRRTIDETPYY R+GRRRFDP+YTY Sbjct: 1901 TSSAVAGPVTTDSISTGNFQSSPRTPQPFMEYVRRTIDETPYYNREGRRRFDPRYTY 1957 >ref|XP_018680741.1| PREDICTED: nuclear pore complex protein GP210 isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_018680742.1| PREDICTED: nuclear pore complex protein GP210 isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_018680743.1| PREDICTED: nuclear pore complex protein GP210 isoform X1 [Musa acuminata subsp. malaccensis] Length = 1958 Score = 86.7 bits (213), Expect = 1e-16 Identities = 41/57 (71%), Positives = 45/57 (78%), Gaps = 1/57 (1%) Frame = -3 Query: 484 TPSPIRRPATADSPS-GNVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYTY 317 T S + P T DS S GN Q SPRTPQP M+YVRRTIDETPYY R+GRRRFDP+YTY Sbjct: 1902 TSSAVAGPVTTDSISTGNFQSSPRTPQPFMEYVRRTIDETPYYNREGRRRFDPRYTY 1958 >ref|XP_020689985.1| nuclear pore complex protein GP210-like [Dendrobium catenatum] Length = 270 Score = 84.0 bits (206), Expect = 2e-16 Identities = 39/56 (69%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = -3 Query: 478 SPIRRPATADSPSG--NVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYTY 317 S + P+T PS N FSPRTPQP ++YVRRTIDETPYYKRDGRRRFDPQ+TY Sbjct: 215 SAVTGPSTPQPPSALANSPFSPRTPQPFVEYVRRTIDETPYYKRDGRRRFDPQHTY 270 >gb|PKU71647.1| hypothetical protein MA16_Dca004489 [Dendrobium catenatum] Length = 295 Score = 84.0 bits (206), Expect = 3e-16 Identities = 39/56 (69%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = -3 Query: 478 SPIRRPATADSPSG--NVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYTY 317 S + P+T PS N FSPRTPQP ++YVRRTIDETPYYKRDGRRRFDPQ+TY Sbjct: 240 SAVTGPSTPQPPSALANSPFSPRTPQPFVEYVRRTIDETPYYKRDGRRRFDPQHTY 295 >ref|XP_020590904.1| LOW QUALITY PROTEIN: nuclear pore complex protein GP210 [Phalaenopsis equestris] Length = 1965 Score = 84.3 bits (207), Expect = 8e-16 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = -3 Query: 463 PATADSPSGNVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYTY 317 P A P+G+ QFSPRTPQP ++YVRRTIDETPYYKRDGRRRFDPQ+TY Sbjct: 1918 PEAASVPAGS-QFSPRTPQPFVEYVRRTIDETPYYKRDGRRRFDPQHTY 1965 >gb|KQL23585.1| hypothetical protein SETIT_028644mg [Setaria italica] Length = 1914 Score = 83.2 bits (204), Expect = 2e-15 Identities = 41/62 (66%), Positives = 47/62 (75%), Gaps = 4/62 (6%) Frame = -3 Query: 490 ASTPS--PIRRPATADSPSG--NVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQY 323 ASTP+ P+ PA P+ N Q SPRTPQP M+YVRRTID+TPYYKRDGRRRF+PQ Sbjct: 1853 ASTPARTPVASPAAMADPASPANGQLSPRTPQPFMEYVRRTIDDTPYYKRDGRRRFNPQN 1912 Query: 322 TY 317 TY Sbjct: 1913 TY 1914 >ref|XP_004956191.1| nuclear pore complex protein GP210 isoform X2 [Setaria italica] Length = 1964 Score = 83.2 bits (204), Expect = 2e-15 Identities = 41/62 (66%), Positives = 47/62 (75%), Gaps = 4/62 (6%) Frame = -3 Query: 490 ASTPS--PIRRPATADSPSG--NVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQY 323 ASTP+ P+ PA P+ N Q SPRTPQP M+YVRRTID+TPYYKRDGRRRF+PQ Sbjct: 1903 ASTPARTPVASPAAMADPASPANGQLSPRTPQPFMEYVRRTIDDTPYYKRDGRRRFNPQN 1962 Query: 322 TY 317 TY Sbjct: 1963 TY 1964 >ref|XP_004956190.1| nuclear pore complex protein GP210 isoform X1 [Setaria italica] Length = 1965 Score = 83.2 bits (204), Expect = 2e-15 Identities = 41/62 (66%), Positives = 47/62 (75%), Gaps = 4/62 (6%) Frame = -3 Query: 490 ASTPS--PIRRPATADSPSG--NVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQY 323 ASTP+ P+ PA P+ N Q SPRTPQP M+YVRRTID+TPYYKRDGRRRF+PQ Sbjct: 1904 ASTPARTPVASPAAMADPASPANGQLSPRTPQPFMEYVRRTIDDTPYYKRDGRRRFNPQN 1963 Query: 322 TY 317 TY Sbjct: 1964 TY 1965 >ref|XP_020155673.1| nuclear pore complex protein GP210 isoform X2 [Aegilops tauschii subsp. tauschii] Length = 1954 Score = 82.8 bits (203), Expect = 3e-15 Identities = 37/61 (60%), Positives = 45/61 (73%), Gaps = 2/61 (3%) Frame = -3 Query: 493 PASTPSPIRRPATADSPSGNV--QFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYT 320 P P+P PATA P+ +FSPRTPQP M+YVR+T+D+TPYYKRD RRRF+PQ T Sbjct: 1894 PRHAPAPAAGPATAPDPASPAIGEFSPRTPQPFMEYVRKTVDDTPYYKRDARRRFNPQNT 1953 Query: 319 Y 317 Y Sbjct: 1954 Y 1954 >ref|XP_020155672.1| nuclear pore complex protein GP210 isoform X1 [Aegilops tauschii subsp. tauschii] Length = 1965 Score = 82.8 bits (203), Expect = 3e-15 Identities = 37/61 (60%), Positives = 45/61 (73%), Gaps = 2/61 (3%) Frame = -3 Query: 493 PASTPSPIRRPATADSPSGNV--QFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYT 320 P P+P PATA P+ +FSPRTPQP M+YVR+T+D+TPYYKRD RRRF+PQ T Sbjct: 1905 PRHAPAPAAGPATAPDPASPAIGEFSPRTPQPFMEYVRKTVDDTPYYKRDARRRFNPQNT 1964 Query: 319 Y 317 Y Sbjct: 1965 Y 1965 >gb|PAN10950.1| hypothetical protein PAHAL_B01763 [Panicum hallii] Length = 1964 Score = 82.4 bits (202), Expect = 4e-15 Identities = 40/59 (67%), Positives = 48/59 (81%) Frame = -3 Query: 493 PASTPSPIRRPATADSPSGNVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYTY 317 PA++P+P+ PA SP+ N Q SPRTPQP M+YVRRTID+TPYYKRD RRRF+PQ TY Sbjct: 1910 PAASPAPMADPA---SPA-NGQLSPRTPQPFMEYVRRTIDDTPYYKRDSRRRFNPQNTY 1964 >gb|OEL31953.1| Nuclear pore complex protein GP210 [Dichanthelium oligosanthes] Length = 1994 Score = 81.6 bits (200), Expect = 7e-15 Identities = 40/59 (67%), Positives = 48/59 (81%) Frame = -3 Query: 493 PASTPSPIRRPATADSPSGNVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYTY 317 PA++P+ + PA SP+ N Q SPRTPQP M+YVRRTID+TPYYKRDGRRRF+PQ TY Sbjct: 1940 PAASPAAMAYPA---SPA-NGQLSPRTPQPFMEYVRRTIDDTPYYKRDGRRRFNPQNTY 1994 >gb|ONM20896.1| Nuclear pore complex protein GP210 [Zea mays] Length = 550 Score = 81.3 bits (199), Expect = 8e-15 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 4/62 (6%) Frame = -3 Query: 490 ASTPS--PIRRPATADSPSG--NVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQY 323 ASTP+ P PA P+ N QFSPRTPQP M+YVRRTID+TPYYKRD RRRF+PQ Sbjct: 489 ASTPARAPAADPAAMADPASPANGQFSPRTPQPFMEYVRRTIDDTPYYKRDARRRFNPQN 548 Query: 322 TY 317 TY Sbjct: 549 TY 550 >ref|XP_006660990.2| PREDICTED: nuclear pore complex protein GP210 isoform X2 [Oryza brachyantha] Length = 1762 Score = 81.3 bits (199), Expect = 1e-14 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = -3 Query: 493 PASTPSPIRRPATADSPSGNV--QFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYT 320 PA P P PA P+ +FSPRTPQP M+YVRRTID+TPYYKRD RRRF+PQ T Sbjct: 1702 PAPAPPPAGSPAAMADPASPATGEFSPRTPQPFMEYVRRTIDDTPYYKRDARRRFNPQNT 1761 Query: 319 Y 317 Y Sbjct: 1762 Y 1762 >ref|NP_001335988.1| uncharacterized protein LOC100384390 [Zea mays] Length = 1911 Score = 81.3 bits (199), Expect = 1e-14 Identities = 41/62 (66%), Positives = 46/62 (74%), Gaps = 4/62 (6%) Frame = -3 Query: 490 ASTPS--PIRRPATADSPSG--NVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQY 323 ASTP+ P PA P+ N QFSPRTPQP M+YVRRTID+TPYYKRD RRRF+PQ Sbjct: 1850 ASTPARAPAADPAAMADPASPANGQFSPRTPQPFMEYVRRTIDDTPYYKRDARRRFNPQN 1909 Query: 322 TY 317 TY Sbjct: 1910 TY 1911 >ref|XP_015696742.1| PREDICTED: nuclear pore complex protein GP210 isoform X1 [Oryza brachyantha] Length = 1957 Score = 81.3 bits (199), Expect = 1e-14 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = -3 Query: 493 PASTPSPIRRPATADSPSGNV--QFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYT 320 PA P P PA P+ +FSPRTPQP M+YVRRTID+TPYYKRD RRRF+PQ T Sbjct: 1897 PAPAPPPAGSPAAMADPASPATGEFSPRTPQPFMEYVRRTIDDTPYYKRDARRRFNPQNT 1956 Query: 319 Y 317 Y Sbjct: 1957 Y 1957 >ref|XP_015866211.1| PREDICTED: nuclear pore complex protein GP210 [Ziziphus jujuba] Length = 1959 Score = 80.9 bits (198), Expect = 1e-14 Identities = 42/59 (71%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -3 Query: 487 STPSPIRRPATADSPSGNVQF--SPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYTY 317 +TPS I P T D S V F SPRTPQP MDYVRRTIDETPYYKRD RRRF+PQ TY Sbjct: 1902 ATPS-IAAPVTPDRGSPTVSFDQSPRTPQPFMDYVRRTIDETPYYKRDARRRFNPQNTY 1959 >ref|XP_022740411.1| nuclear pore complex protein GP210 isoform X4 [Durio zibethinus] Length = 1653 Score = 80.5 bits (197), Expect = 2e-14 Identities = 39/61 (63%), Positives = 46/61 (75%), Gaps = 2/61 (3%) Frame = -3 Query: 493 PASTPSPIRRPATAD--SPSGNVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYT 320 P++ P PI P T + SP + SPRTPQP +DYVRRTIDETPYYKR+GRRRF+PQ T Sbjct: 1593 PSTPPPPIAAPVTPERSSPLLLNEQSPRTPQPFVDYVRRTIDETPYYKREGRRRFNPQNT 1652 Query: 319 Y 317 Y Sbjct: 1653 Y 1653 >ref|XP_022740410.1| nuclear pore complex protein GP210 isoform X3 [Durio zibethinus] Length = 1815 Score = 80.5 bits (197), Expect = 2e-14 Identities = 39/61 (63%), Positives = 46/61 (75%), Gaps = 2/61 (3%) Frame = -3 Query: 493 PASTPSPIRRPATAD--SPSGNVQFSPRTPQPLMDYVRRTIDETPYYKRDGRRRFDPQYT 320 P++ P PI P T + SP + SPRTPQP +DYVRRTIDETPYYKR+GRRRF+PQ T Sbjct: 1755 PSTPPPPIAAPVTPERSSPLLLNEQSPRTPQPFVDYVRRTIDETPYYKREGRRRFNPQNT 1814 Query: 319 Y 317 Y Sbjct: 1815 Y 1815