BLASTX nr result
ID: Cheilocostus21_contig00035727
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00035727 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009390384.1| PREDICTED: uncharacterized protein LOC103976... 54 4e-06 >ref|XP_009390384.1| PREDICTED: uncharacterized protein LOC103976787 [Musa acuminata subsp. malaccensis] Length = 153 Score = 53.5 bits (127), Expect = 4e-06 Identities = 24/40 (60%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = -1 Query: 420 GNSRKTPGTPIEFPVEPNTNKGKP-KFKGCRCLSWLFK*K 304 G+SRK+PGTPI+ +E T+K P + KGCRCLSW+FK K Sbjct: 111 GDSRKSPGTPIKLSIESGTHKKDPNECKGCRCLSWIFKCK 150