BLASTX nr result
ID: Cheilocostus21_contig00035557
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00035557 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009411868.2| PREDICTED: pentatricopeptide repeat-containi... 94 2e-19 ref|XP_010911356.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-12 ref|XP_008809841.1| PREDICTED: pentatricopeptide repeat-containi... 72 9e-12 ref|XP_011651207.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-10 ref|XP_011651206.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-10 gb|KGN57449.1| hypothetical protein Csa_3G187240 [Cucumis sativus] 69 1e-10 ref|XP_016902068.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-10 ref|XP_011651205.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-10 ref|XP_023891303.1| pentatricopeptide repeat-containing protein ... 68 2e-10 ref|XP_023901041.1| pentatricopeptide repeat-containing protein ... 68 3e-10 ref|XP_004500093.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-10 ref|XP_013459812.1| organelle transcript processing protein, put... 68 3e-10 dbj|BAU03574.1| hypothetical protein VIGAN_UM132700 [Vigna angul... 65 4e-10 gb|OIV95535.1| hypothetical protein TanjilG_10923 [Lupinus angus... 66 8e-10 gb|OAY66968.1| Pentatricopeptide repeat-containing protein, chlo... 66 9e-10 ref|XP_020108437.1| pentatricopeptide repeat-containing protein ... 66 9e-10 ref|XP_007137380.1| hypothetical protein PHAVU_009G122500g [Phas... 66 9e-10 ref|XP_019417956.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-10 ref|XP_020108436.1| pentatricopeptide repeat-containing protein ... 66 9e-10 ref|XP_017257206.1| PREDICTED: putative pentatricopeptide repeat... 66 1e-09 >ref|XP_009411868.2| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like, partial [Musa acuminata subsp. malaccensis] Length = 572 Score = 94.0 bits (232), Expect = 2e-19 Identities = 47/71 (66%), Positives = 54/71 (76%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV VRGVM + +I K+PGCSFIELNG+VHEFLATDRSHHQS+ I E L VI+ HL ES Sbjct: 501 DVNKVRGVMRNWSIHKIPGCSFIELNGIVHEFLATDRSHHQSDMIYEFLWVIHGHLFSES 560 Query: 264 YDKVYHLT*EG 232 YD+ T EG Sbjct: 561 YDESCLSTWEG 571 >ref|XP_010911356.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like [Elaeis guineensis] Length = 609 Score = 72.4 bits (176), Expect = 6e-12 Identities = 36/61 (59%), Positives = 44/61 (72%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV VR VM +IQK PGCSFIE+NG VHEF A D SH ++E I +LL IN+HL+ E+ Sbjct: 520 DVNRVRRVMYVQSIQKQPGCSFIEINGNVHEFFAKDTSHPETEVIHGVLLWINKHLLSET 579 Query: 264 Y 262 Y Sbjct: 580 Y 580 >ref|XP_008809841.1| PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like [Phoenix dactylifera] Length = 599 Score = 72.0 bits (175), Expect = 9e-12 Identities = 36/61 (59%), Positives = 43/61 (70%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV VR VM NIQK PGCSFIE+NG VHEF A SHH++E I +LL I +H++ ES Sbjct: 520 DVNRVRRVMYVQNIQKQPGCSFIEINGNVHEFFAKVTSHHEAEVIHGVLLWIYKHILSES 579 Query: 264 Y 262 Y Sbjct: 580 Y 580 >ref|XP_011651207.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like isoform X3 [Cucumis sativus] Length = 613 Score = 68.6 bits (166), Expect = 1e-10 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV +RG+M+ H + K+PGCS IE NGV+HEFLA D++H ++I ++L+ + L LE Sbjct: 462 DVLEIRGMMTKHRVLKIPGCSMIEANGVIHEFLAGDKTHPDMDAIEDMLVEMAMKLKLEG 521 Query: 264 Y 262 Y Sbjct: 522 Y 522 >ref|XP_011651206.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like isoform X2 [Cucumis sativus] Length = 617 Score = 68.6 bits (166), Expect = 1e-10 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV +RG+M+ H + K+PGCS IE NGV+HEFLA D++H ++I ++L+ + L LE Sbjct: 466 DVLEIRGMMTKHRVLKIPGCSMIEANGVIHEFLAGDKTHPDMDAIEDMLVEMAMKLKLEG 525 Query: 264 Y 262 Y Sbjct: 526 Y 526 >gb|KGN57449.1| hypothetical protein Csa_3G187240 [Cucumis sativus] Length = 638 Score = 68.6 bits (166), Expect = 1e-10 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV +RG+M+ H + K+PGCS IE NGV+HEFLA D++H ++I ++L+ + L LE Sbjct: 487 DVLEIRGMMTKHRVLKIPGCSMIEANGVIHEFLAGDKTHPDMDAIEDMLVEMAMKLKLEG 546 Query: 264 Y 262 Y Sbjct: 547 Y 547 >ref|XP_016902068.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Cucumis melo] Length = 812 Score = 68.6 bits (166), Expect = 1e-10 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV +RG+M+ H + K+PGCS IE NGV+HEFLA D++H ++I ++L+ + L LE Sbjct: 661 DVLEIRGMMTKHRVLKIPGCSMIEANGVIHEFLAGDKTHPNMDAIEDMLVEMAMKLKLEG 720 Query: 264 Y 262 Y Sbjct: 721 Y 721 >ref|XP_011651205.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like isoform X1 [Cucumis sativus] Length = 812 Score = 68.6 bits (166), Expect = 1e-10 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV +RG+M+ H + K+PGCS IE NGV+HEFLA D++H ++I ++L+ + L LE Sbjct: 661 DVLEIRGMMTKHRVLKIPGCSMIEANGVIHEFLAGDKTHPDMDAIEDMLVEMAMKLKLEG 720 Query: 264 Y 262 Y Sbjct: 721 Y 721 >ref|XP_023891303.1| pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Quercus suber] Length = 619 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/63 (50%), Positives = 45/63 (71%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DVK++R M+ IQKLPGCSFIE++GVVHEF D SH Q + I E+++ IN+ + E Sbjct: 555 DVKNMRKSMALQRIQKLPGCSFIEIDGVVHEFFVADDSHCQMDFIYEMIIRINKVIQAEV 614 Query: 264 YDK 256 +D+ Sbjct: 615 FDQ 617 >ref|XP_023901041.1| pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Quercus suber] Length = 618 Score = 67.8 bits (164), Expect = 3e-10 Identities = 32/62 (51%), Positives = 44/62 (70%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DVK++R M+ IQKLPGCSFIE++GVVHEF D SH Q + I E+++ IN+ + E Sbjct: 554 DVKNMRKSMALQRIQKLPGCSFIEIDGVVHEFFVADDSHCQMDFIYEMIIRINKVIQAEV 613 Query: 264 YD 259 +D Sbjct: 614 FD 615 >ref|XP_004500093.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Cicer arietinum] Length = 785 Score = 67.8 bits (164), Expect = 3e-10 Identities = 29/61 (47%), Positives = 41/61 (67%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV +RG+M+ H + K+PGCS +E NG+VHEFLA D++H Q I +L V+ L +E Sbjct: 634 DVLEIRGIMAQHGVVKMPGCSMLEANGIVHEFLAGDKTHPQINDIEHMLDVMAAKLKIEG 693 Query: 264 Y 262 Y Sbjct: 694 Y 694 >ref|XP_013459812.1| organelle transcript processing protein, putative [Medicago truncatula] gb|KEH33843.1| organelle transcript processing protein, putative [Medicago truncatula] Length = 1150 Score = 67.8 bits (164), Expect = 3e-10 Identities = 29/61 (47%), Positives = 41/61 (67%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV +RG+M+ H + K+PGCS IE NG+VHEFLA D++H Q + I +L + L +E Sbjct: 661 DVLEIRGIMAQHGVVKMPGCSMIEANGIVHEFLAGDKTHPQIKDIEHMLNEVAAKLKIEG 720 Query: 264 Y 262 Y Sbjct: 721 Y 721 >dbj|BAU03574.1| hypothetical protein VIGAN_UM132700 [Vigna angularis var. angularis] Length = 186 Score = 65.1 bits (157), Expect = 4e-10 Identities = 28/61 (45%), Positives = 40/61 (65%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 +V +RG+M+ H + K PGCS IE NG+VHEFLA D++H Q I +L ++ L +E Sbjct: 35 NVLEIRGIMAQHGVVKTPGCSMIEANGIVHEFLAGDKTHPQISDIEHMLDEVSAKLKIEG 94 Query: 264 Y 262 Y Sbjct: 95 Y 95 >gb|OIV95535.1| hypothetical protein TanjilG_10923 [Lupinus angustifolius] Length = 453 Score = 66.2 bits (160), Expect = 8e-10 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV +RG+M+ H + K PGCS IE NG+VHEFLA D +H I +L V+ L +E Sbjct: 302 DVLEIRGIMAQHGVVKTPGCSMIEANGIVHEFLAGDMTHPHKNDIEHMLDVVAEKLKIEG 361 Query: 264 Y 262 Y Sbjct: 362 Y 362 >gb|OAY66968.1| Pentatricopeptide repeat-containing protein, chloroplastic [Ananas comosus] Length = 745 Score = 66.2 bits (160), Expect = 9e-10 Identities = 31/61 (50%), Positives = 42/61 (68%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 +VK +RG+M + K+PGCS IE GVVHEFLA DR+H Q + I+E+L + R L +E Sbjct: 594 NVKELRGLMKQRGVVKVPGCSLIESGGVVHEFLAGDRTHPQIKEINEMLDEVARRLRIEG 653 Query: 264 Y 262 Y Sbjct: 654 Y 654 >ref|XP_020108437.1| pentatricopeptide repeat-containing protein At3g62890-like isoform X2 [Ananas comosus] Length = 768 Score = 66.2 bits (160), Expect = 9e-10 Identities = 31/61 (50%), Positives = 42/61 (68%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 +VK +RG+M + K+PGCS IE GVVHEFLA DR+H Q + I+E+L + R L +E Sbjct: 617 NVKELRGLMKQRGVVKVPGCSLIESGGVVHEFLAGDRTHPQIKEINEMLDEVARRLRIEG 676 Query: 264 Y 262 Y Sbjct: 677 Y 677 >ref|XP_007137380.1| hypothetical protein PHAVU_009G122500g [Phaseolus vulgaris] gb|ESW09374.1| hypothetical protein PHAVU_009G122500g [Phaseolus vulgaris] Length = 774 Score = 66.2 bits (160), Expect = 9e-10 Identities = 29/61 (47%), Positives = 40/61 (65%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 +V +RG+M+ H + K PGCS IE NG+VHEFLA D++H Q I +L V+ L +E Sbjct: 623 NVLEIRGIMAQHGVVKTPGCSMIEANGIVHEFLAGDKTHPQISDIEHMLDVVAAKLKIEG 682 Query: 264 Y 262 Y Sbjct: 683 Y 683 >ref|XP_019417956.1| PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Lupinus angustifolius] Length = 794 Score = 66.2 bits (160), Expect = 9e-10 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 DV +RG+M+ H + K PGCS IE NG+VHEFLA D +H I +L V+ L +E Sbjct: 643 DVLEIRGIMAQHGVVKTPGCSMIEANGIVHEFLAGDMTHPHKNDIEHMLDVVAEKLKIEG 702 Query: 264 Y 262 Y Sbjct: 703 Y 703 >ref|XP_020108436.1| pentatricopeptide repeat-containing protein At3g62890-like isoform X1 [Ananas comosus] Length = 796 Score = 66.2 bits (160), Expect = 9e-10 Identities = 31/61 (50%), Positives = 42/61 (68%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 +VK +RG+M + K+PGCS IE GVVHEFLA DR+H Q + I+E+L + R L +E Sbjct: 645 NVKELRGLMKQRGVVKVPGCSLIESGGVVHEFLAGDRTHPQIKEINEMLDEVARRLRIEG 704 Query: 264 Y 262 Y Sbjct: 705 Y 705 >ref|XP_017257206.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930 [Daucus carota subsp. sativus] Length = 644 Score = 65.9 bits (159), Expect = 1e-09 Identities = 31/61 (50%), Positives = 43/61 (70%) Frame = -2 Query: 444 DVKSVRGVMSSHNIQKLPGCSFIELNGVVHEFLATDRSHHQSESISELLLVINRHLVLES 265 D+K +R +M+ I+K+PGCS IE+NG++HEF+A DRSH QSE I L + +LVL Sbjct: 575 DLKVLRKIMTDKGIKKIPGCSSIEVNGIIHEFVAGDRSHPQSEDICLKLENLKENLVLVG 634 Query: 264 Y 262 Y Sbjct: 635 Y 635