BLASTX nr result
ID: Cheilocostus21_contig00035299
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00035299 (1442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009400294.1| PREDICTED: ferredoxin-thioredoxin reductase,... 73 2e-11 ref|XP_008776379.1| PREDICTED: ferredoxin-thioredoxin reductase,... 71 6e-11 ref|XP_008806674.1| PREDICTED: ferredoxin-thioredoxin reductase,... 70 2e-10 ref|XP_010933312.1| PREDICTED: ferredoxin-thioredoxin reductase,... 67 2e-09 ref|XP_010918464.1| PREDICTED: ferredoxin-thioredoxin reductase,... 67 2e-09 ref|XP_020081815.1| ferredoxin-thioredoxin reductase, variable c... 66 5e-09 gb|PKA55426.1| Ferredoxin-thioredoxin reductase, variable chain ... 65 5e-09 gb|OEL14868.1| Ferredoxin-thioredoxin reductase, variable chain ... 65 8e-09 ref|XP_020704419.1| ferredoxin-thioredoxin reductase, variable c... 65 8e-09 gb|OAY32208.1| hypothetical protein MANES_14G174500 [Manihot esc... 63 1e-08 gb|PAN07266.1| hypothetical protein PAHAL_A02698 [Panicum hallii] 64 1e-08 ref|XP_002454231.2| ferredoxin-thioredoxin reductase, variable c... 64 2e-08 gb|OAY85904.1| Ferredoxin-thioredoxin reductase, variable chain ... 63 2e-08 ref|XP_020085065.1| ferredoxin-thioredoxin reductase, variable c... 64 2e-08 gb|ACF78659.1| unknown [Zea mays] 60 3e-08 ref|XP_009389040.1| PREDICTED: ferredoxin-thioredoxin reductase,... 64 3e-08 gb|PNT69117.1| hypothetical protein BRADI_3g49790v3 [Brachypodiu... 63 5e-08 ref|XP_015689089.1| PREDICTED: ferredoxin-thioredoxin reductase,... 62 6e-08 gb|EMS52056.1| Ferredoxin-thioredoxin reductase, variable chain ... 59 7e-08 sp|P80680.1|FTRV_MAIZE RecName: Full=Ferredoxin-thioredoxin redu... 60 8e-08 >ref|XP_009400294.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Musa acuminata subsp. malaccensis] ref|XP_009400296.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Musa acuminata subsp. malaccensis] ref|XP_009400297.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Musa acuminata subsp. malaccensis] ref|XP_018682165.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Musa acuminata subsp. malaccensis] ref|XP_018682166.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Musa acuminata subsp. malaccensis] Length = 163 Score = 72.8 bits (177), Expect = 2e-11 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYLTSLD 109 ++ + WKGKRIS NLP VEF+IDVEGQP PVKF HL+EDEFEYL S D Sbjct: 113 KQYVGVWKGKRISANLPFKVEFKIDVEGQPRPVKFFAHLKEDEFEYLPSSD 163 >ref|XP_008776379.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Phoenix dactylifera] ref|XP_008778280.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Phoenix dactylifera] Length = 159 Score = 71.2 bits (173), Expect = 6e-11 Identities = 34/51 (66%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYLTSLD 109 ++ L WKGKRIS NLP VEFQ+ VEGQP PVKF HL++DEFEYL S D Sbjct: 104 KQYLGLWKGKRISANLPFKVEFQVAVEGQPKPVKFFAHLKDDEFEYLPSSD 154 >ref|XP_008806674.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Phoenix dactylifera] Length = 163 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYLTSLD 109 ++ + WKGKRIS NLP VEF + VEGQP PVKF HL+EDEFEYL S D Sbjct: 113 KQYVALWKGKRISANLPFKVEFHVAVEGQPKPVKFFAHLKEDEFEYLPSSD 163 >ref|XP_010933312.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Elaeis guineensis] Length = 162 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/51 (60%), Positives = 38/51 (74%), Gaps = 1/51 (1%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYLTSLD 109 ++ + WKGKRIS NLP VEF + V+GQP PVKF HL++DEFEYL S D Sbjct: 112 KQYVGLWKGKRISANLPFKVEFHVAVDGQPKPVKFFAHLKDDEFEYLPSSD 162 >ref|XP_010918464.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Elaeis guineensis] Length = 156 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/47 (63%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYL 121 ++ + WKGKRIS NLP +EF + VEGQP PVKF HL+EDEFEYL Sbjct: 109 KQYVALWKGKRISANLPFKIEFHVAVEGQPKPVKFFAHLKEDEFEYL 155 >ref|XP_020081815.1| ferredoxin-thioredoxin reductase, variable chain-like [Ananas comosus] Length = 160 Score = 65.9 bits (159), Expect = 5e-09 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYLTSLD 109 ++ L WKGKRIS NLP VEF I ++GQ PVKF HLREDEFEY+ S D Sbjct: 107 KQYLGVWKGKRISANLPFKVEFLIRIDGQDSPVKFFAHLREDEFEYVPSSD 157 >gb|PKA55426.1| Ferredoxin-thioredoxin reductase, variable chain [Apostasia shenzhenica] Length = 150 Score = 65.5 bits (158), Expect = 5e-09 Identities = 32/45 (71%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = -3 Query: 240 WKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYLTSLD 109 WKGKRIS NLP VEF + VEGQ P+KF HLREDEFEYL+S D Sbjct: 106 WKGKRISANLPFKVEFLLAVEGQEKPIKFAAHLREDEFEYLSSSD 150 >gb|OEL14868.1| Ferredoxin-thioredoxin reductase, variable chain [Dichanthelium oligosanthes] Length = 154 Score = 65.1 bits (157), Expect = 8e-09 Identities = 30/47 (63%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYL 121 ++ + WKGKRI+ NLP VEFQ+ VEGQP PVKF HLREDEFE++ Sbjct: 105 KQYVGVWKGKRITANLPFKVEFQLAVEGQPKPVKFFVHLREDEFEFV 151 >ref|XP_020704419.1| ferredoxin-thioredoxin reductase, variable chain-like [Dendrobium catenatum] gb|PKU65898.1| Ferredoxin-thioredoxin reductase, variable chain [Dendrobium catenatum] Length = 157 Score = 65.1 bits (157), Expect = 8e-09 Identities = 33/51 (64%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYLTSLD 109 ++ + WKGKRIS NLP VEF I V GQ PVKF+ HLREDEFEYL S D Sbjct: 107 KQYVGVWKGKRISANLPFRVEFFISVAGQEKPVKFVAHLREDEFEYLPSSD 157 >gb|OAY32208.1| hypothetical protein MANES_14G174500 [Manihot esculenta] Length = 109 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/49 (59%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = -3 Query: 264 Q*RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYL 121 Q ++ + WKGKRIS NLP VEF +D+EG+ CP+KF HL+EDEF+YL Sbjct: 61 QLKQYVALWKGKRISANLPYKVEFVVDIEGR-CPIKFFAHLKEDEFDYL 108 >gb|PAN07266.1| hypothetical protein PAHAL_A02698 [Panicum hallii] Length = 151 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -3 Query: 240 WKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYL 121 WKGKRI+ NLP VEFQI VEGQP PV+F HLREDEFE++ Sbjct: 108 WKGKRITANLPFKVEFQIAVEGQPKPVRFFAHLREDEFEFV 148 >ref|XP_002454231.2| ferredoxin-thioredoxin reductase, variable chain [Sorghum bicolor] gb|KXG30703.1| hypothetical protein SORBI_3004G227200 [Sorghum bicolor] Length = 157 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = -3 Query: 240 WKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYL 121 WKGKR++ NLP VEFQ+ V+GQP PV+F THLREDEFE++ Sbjct: 114 WKGKRVTANLPFKVEFQLAVDGQPKPVRFFTHLREDEFEFV 154 >gb|OAY85904.1| Ferredoxin-thioredoxin reductase, variable chain [Ananas comosus] Length = 118 Score = 62.8 bits (151), Expect = 2e-08 Identities = 30/51 (58%), Positives = 36/51 (70%), Gaps = 1/51 (1%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYLTSLD 109 ++ L WKGKR S NLP VEF I ++GQ PVKF +H REDEFEY+ S D Sbjct: 65 KQYLGVWKGKRTSANLPFKVEFLIRIDGQDSPVKFFSHFREDEFEYVPSSD 115 >ref|XP_020085065.1| ferredoxin-thioredoxin reductase, variable chain-like [Ananas comosus] gb|OAY74891.1| Ferredoxin-thioredoxin reductase, variable chain [Ananas comosus] Length = 163 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYLTSLD 109 ++ + WKGKRIS NLP VEF I ++GQ PVKF HLREDEFEY+ S D Sbjct: 110 KQYVGVWKGKRISANLPFKVEFLIRIDGQDRPVKFFAHLREDEFEYVPSSD 160 >gb|ACF78659.1| unknown [Zea mays] Length = 55 Score = 60.5 bits (145), Expect = 3e-08 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -3 Query: 240 WKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYL 121 WKGKR++ N P VEF++ VEGQP PV+F HLREDEFE++ Sbjct: 12 WKGKRVTANFPFKVEFELAVEGQPKPVRFFAHLREDEFEFV 52 >ref|XP_009389040.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Musa acuminata subsp. malaccensis] Length = 164 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -3 Query: 237 KGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYLTS 115 KGKRIS NLP VEF+I+VEGQ PVKF HLREDEFEYL+S Sbjct: 122 KGKRISANLPFKVEFEINVEGQVRPVKFFAHLREDEFEYLSS 163 >gb|PNT69117.1| hypothetical protein BRADI_3g49790v3 [Brachypodium distachyon] Length = 154 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYL 121 ++ + WKGKRI+ N P VEFQ+ VEGQP PVK HLREDEFE++ Sbjct: 105 KQYVGVWKGKRITANFPFKVEFQVSVEGQPKPVKLFVHLREDEFEFI 151 >ref|XP_015689089.1| PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Oryza brachyantha] Length = 149 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYL 121 ++ + WKGKRI+ N P VEF + VEGQP PV+F HLREDEFE++ Sbjct: 101 KQYVAIWKGKRITANFPFKVEFNLSVEGQPKPVRFFVHLREDEFEFI 147 >gb|EMS52056.1| Ferredoxin-thioredoxin reductase, variable chain [Triticum urartu] Length = 55 Score = 59.3 bits (142), Expect = 7e-08 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = -3 Query: 258 RELLQFWKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYL 121 ++ + WKGKRI+ N P VEFQ+ V+ QP PVK HLREDEFEY+ Sbjct: 6 KQYVGVWKGKRITANFPFKVEFQLTVDTQPKPVKLFVHLREDEFEYI 52 >sp|P80680.1|FTRV_MAIZE RecName: Full=Ferredoxin-thioredoxin reductase, variable chain; Short=FTR-V; AltName: Full=Ferredoxin-thioredoxin reductase subunit A; Short=FTR-A Length = 97 Score = 60.5 bits (145), Expect = 8e-08 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -3 Query: 240 WKGKRISVNLPL-VEFQIDVEGQPCPVKFLTHLREDEFEYL 121 WKGKR++ N P VEF++ VEGQP PV+F HLREDEFE++ Sbjct: 55 WKGKRVTANFPFKVEFELAVEGQPKPVRFFAHLREDEFEFV 95