BLASTX nr result
ID: Cheilocostus21_contig00035192
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00035192 (548 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010910630.1| PREDICTED: protein ERD1 homolog 2-like [Elae... 209 2e-65 ref|XP_008793969.1| PREDICTED: SPX and EXS domain-containing pro... 211 1e-63 ref|XP_009408646.1| PREDICTED: SPX and EXS domain-containing pro... 210 3e-63 ref|XP_008793968.1| PREDICTED: SPX and EXS domain-containing pro... 211 4e-63 ref|XP_009408645.1| PREDICTED: SPX and EXS domain-containing pro... 210 6e-63 ref|XP_009408644.1| PREDICTED: SPX and EXS domain-containing pro... 210 7e-63 ref|XP_017702035.1| PREDICTED: SPX and EXS domain-containing pro... 206 6e-62 ref|XP_010905478.1| PREDICTED: SPX and EXS domain-containing pro... 205 2e-61 ref|XP_008811462.1| PREDICTED: SPX and EXS domain-containing pro... 206 2e-61 ref|XP_010905476.1| PREDICTED: SPX and EXS domain-containing pro... 205 5e-61 gb|OAY79692.1| SPX and EXS domain-containing protein 1 [Ananas c... 200 2e-59 ref|XP_009398236.1| PREDICTED: SPX and EXS domain-containing pro... 200 7e-59 gb|PON93278.1| EXS, C-terminal [Trema orientalis] 195 6e-58 ref|XP_020096304.1| SPX and EXS domain-containing protein 5 isof... 197 1e-57 ref|XP_010927452.2| PREDICTED: SPX and EXS domain-containing pro... 196 1e-57 gb|ONM32884.1| EXS, C-terminal [Zea mays] 187 2e-57 ref|XP_015881108.1| PREDICTED: SPX and EXS domain-containing pro... 196 2e-57 gb|PON68780.1| EXS, C-terminal [Parasponia andersonii] 193 3e-57 gb|ONM01774.1| EXS (ERD1/XPR1/SYG1) family protein [Zea mays] 193 5e-57 ref|NP_001334153.1| SPX and EXS domain-containing protein 1-like... 193 1e-56 >ref|XP_010910630.1| PREDICTED: protein ERD1 homolog 2-like [Elaeis guineensis] Length = 227 Score = 209 bits (532), Expect = 2e-65 Identities = 93/114 (81%), Positives = 106/114 (92%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLSV TRIFKFKNPH+ TNLL+G+ WV+YW+IGSNL+LRCTWTYKLSAHLRHNYLTV Sbjct: 106 RDWDLSVFTRIFKFKNPHLCTNLLYGRIWVFYWMIGSNLILRCTWTYKLSAHLRHNYLTV 165 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEI+RRFQWIFFRVENEWNKMT KQ++ELST +IP+EE++LLG A HNV Sbjct: 166 FTITALEILRRFQWIFFRVENEWNKMTAKQNIELSTENIPKEEERLLGPASHNV 219 >ref|XP_008793969.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X2 [Phoenix dactylifera] Length = 425 Score = 211 bits (536), Expect = 1e-63 Identities = 95/114 (83%), Positives = 105/114 (92%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLSV TRIFKFKNPH+ TNLL+G+ WV+YWVIGSNL+LRCTWTYKLSAHLRHNYLTV Sbjct: 312 RDWDLSVFTRIFKFKNPHLCTNLLYGRIWVFYWVIGSNLILRCTWTYKLSAHLRHNYLTV 371 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F I ALEIMRRFQWIFFRVENEWNKMT +QS+ELST +IP+EED+LLG A HNV Sbjct: 372 FTIAALEIMRRFQWIFFRVENEWNKMTARQSIELSTENIPKEEDRLLGPAGHNV 425 >ref|XP_009408646.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X3 [Musa acuminata subsp. malaccensis] Length = 426 Score = 210 bits (534), Expect = 3e-63 Identities = 97/115 (84%), Positives = 107/115 (93%), Gaps = 1/115 (0%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLSV TRIFKFKNPHI TNLL+G++WVYYWVIGSNL+ RCTWTYKLSAHLRHNYLTV Sbjct: 312 RDWDLSVFTRIFKFKNPHICTNLLYGRKWVYYWVIGSNLIFRCTWTYKLSAHLRHNYLTV 371 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMT-NKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEIMRRFQWIFFRVENEWNK+T +K SLELS ++IP+EED+LLGSA HNV Sbjct: 372 FTITALEIMRRFQWIFFRVENEWNKITSSKPSLELSGNEIPKEEDRLLGSATHNV 426 >ref|XP_008793968.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X1 [Phoenix dactylifera] Length = 472 Score = 211 bits (536), Expect = 4e-63 Identities = 95/114 (83%), Positives = 105/114 (92%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLSV TRIFKFKNPH+ TNLL+G+ WV+YWVIGSNL+LRCTWTYKLSAHLRHNYLTV Sbjct: 359 RDWDLSVFTRIFKFKNPHLCTNLLYGRIWVFYWVIGSNLILRCTWTYKLSAHLRHNYLTV 418 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F I ALEIMRRFQWIFFRVENEWNKMT +QS+ELST +IP+EED+LLG A HNV Sbjct: 419 FTIAALEIMRRFQWIFFRVENEWNKMTARQSIELSTENIPKEEDRLLGPAGHNV 472 >ref|XP_009408645.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X2 [Musa acuminata subsp. malaccensis] Length = 456 Score = 210 bits (534), Expect = 6e-63 Identities = 97/115 (84%), Positives = 107/115 (93%), Gaps = 1/115 (0%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLSV TRIFKFKNPHI TNLL+G++WVYYWVIGSNL+ RCTWTYKLSAHLRHNYLTV Sbjct: 342 RDWDLSVFTRIFKFKNPHICTNLLYGRKWVYYWVIGSNLIFRCTWTYKLSAHLRHNYLTV 401 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMT-NKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEIMRRFQWIFFRVENEWNK+T +K SLELS ++IP+EED+LLGSA HNV Sbjct: 402 FTITALEIMRRFQWIFFRVENEWNKITSSKPSLELSGNEIPKEEDRLLGSATHNV 456 >ref|XP_009408644.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_018685030.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_018685031.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 462 Score = 210 bits (534), Expect = 7e-63 Identities = 97/115 (84%), Positives = 107/115 (93%), Gaps = 1/115 (0%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLSV TRIFKFKNPHI TNLL+G++WVYYWVIGSNL+ RCTWTYKLSAHLRHNYLTV Sbjct: 348 RDWDLSVFTRIFKFKNPHICTNLLYGRKWVYYWVIGSNLIFRCTWTYKLSAHLRHNYLTV 407 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMT-NKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEIMRRFQWIFFRVENEWNK+T +K SLELS ++IP+EED+LLGSA HNV Sbjct: 408 FTITALEIMRRFQWIFFRVENEWNKITSSKPSLELSGNEIPKEEDRLLGSATHNV 462 >ref|XP_017702035.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X2 [Phoenix dactylifera] ref|XP_017702036.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X2 [Phoenix dactylifera] Length = 425 Score = 206 bits (525), Expect = 6e-62 Identities = 93/114 (81%), Positives = 104/114 (91%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLSV TRIFKFKNPH T+LL+G+ WV+YWVIGSNL+LRCTWTYKLSAHLRHNYLTV Sbjct: 312 RDWDLSVFTRIFKFKNPHRCTSLLYGRIWVFYWVIGSNLILRCTWTYKLSAHLRHNYLTV 371 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEI RRFQWIFFRVENEWNKMT KQS+ELST D+P+EED+LLG A H++ Sbjct: 372 FTITALEISRRFQWIFFRVENEWNKMTAKQSIELSTEDVPKEEDRLLGPASHSM 425 >ref|XP_010905478.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X2 [Elaeis guineensis] ref|XP_010905480.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X2 [Elaeis guineensis] ref|XP_019701952.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X2 [Elaeis guineensis] Length = 425 Score = 205 bits (522), Expect = 2e-61 Identities = 92/114 (80%), Positives = 104/114 (91%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLSV TRIFKFK PH+ T+LL+G+ WV+YWVIGSNL+LRCTWTYKLSAHLRHNYLTV Sbjct: 312 RDWDLSVFTRIFKFKAPHLCTSLLYGRIWVFYWVIGSNLILRCTWTYKLSAHLRHNYLTV 371 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEI RRFQWIFFRVENEWNKMT KQ++ELST D+P+EED+LLG A H+V Sbjct: 372 FTITALEISRRFQWIFFRVENEWNKMTAKQNIELSTEDVPKEEDRLLGPASHSV 425 >ref|XP_008811462.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X1 [Phoenix dactylifera] Length = 472 Score = 206 bits (525), Expect = 2e-61 Identities = 93/114 (81%), Positives = 104/114 (91%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLSV TRIFKFKNPH T+LL+G+ WV+YWVIGSNL+LRCTWTYKLSAHLRHNYLTV Sbjct: 359 RDWDLSVFTRIFKFKNPHRCTSLLYGRIWVFYWVIGSNLILRCTWTYKLSAHLRHNYLTV 418 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEI RRFQWIFFRVENEWNKMT KQS+ELST D+P+EED+LLG A H++ Sbjct: 419 FTITALEISRRFQWIFFRVENEWNKMTAKQSIELSTEDVPKEEDRLLGPASHSM 472 >ref|XP_010905476.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X1 [Elaeis guineensis] Length = 472 Score = 205 bits (522), Expect = 5e-61 Identities = 92/114 (80%), Positives = 104/114 (91%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLSV TRIFKFK PH+ T+LL+G+ WV+YWVIGSNL+LRCTWTYKLSAHLRHNYLTV Sbjct: 359 RDWDLSVFTRIFKFKAPHLCTSLLYGRIWVFYWVIGSNLILRCTWTYKLSAHLRHNYLTV 418 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEI RRFQWIFFRVENEWNKMT KQ++ELST D+P+EED+LLG A H+V Sbjct: 419 FTITALEISRRFQWIFFRVENEWNKMTAKQNIELSTEDVPKEEDRLLGPASHSV 472 >gb|OAY79692.1| SPX and EXS domain-containing protein 1 [Ananas comosus] Length = 429 Score = 200 bits (508), Expect = 2e-59 Identities = 89/114 (78%), Positives = 106/114 (92%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLS+++R+FKFKNP ++T+ L+G+ W+YYWVIGSNLVLRCTWTYKLSAHLRHNY+TV Sbjct: 317 RDWDLSILSRVFKFKNPSLITSYLYGRIWIYYWVIGSNLVLRCTWTYKLSAHLRHNYITV 376 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F I ALEI+RRFQWIFFRVENEWNKMT+KQS+ELST D+P+EED LL SA+HNV Sbjct: 377 FTIMALEIVRRFQWIFFRVENEWNKMTSKQSIELST-DLPKEEDPLLSSANHNV 429 >ref|XP_009398236.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Musa acuminata subsp. malaccensis] ref|XP_018680139.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Musa acuminata subsp. malaccensis] Length = 475 Score = 200 bits (508), Expect = 7e-59 Identities = 93/117 (79%), Positives = 103/117 (88%), Gaps = 3/117 (2%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLS +RIFKFKNPHI TNL +G+ WVYYWVIGSNL+LRCTWTYKLSAHLRHN+LTV Sbjct: 359 RDWDLSAFSRIFKFKNPHICTNLFYGRIWVYYWVIGSNLILRCTWTYKLSAHLRHNHLTV 418 Query: 366 FAITALEIMRRFQWIFFRVENEWNK---MTNKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEIMRRFQWIFFRVENEWNK M +K SLELS ++ P EED+LLGSA+HNV Sbjct: 419 FTITALEIMRRFQWIFFRVENEWNKMMMMMSKPSLELSINETPEEEDRLLGSANHNV 475 >gb|PON93278.1| EXS, C-terminal [Trema orientalis] Length = 389 Score = 195 bits (496), Expect = 6e-58 Identities = 86/114 (75%), Positives = 101/114 (88%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLS TRIFKF HIL+NLL+G++WVY+WV+GSNL+LRCTWTYKLSAHLRHNYLTV Sbjct: 276 RDWDLSGFTRIFKFNRTHILSNLLYGRKWVYFWVLGSNLILRCTWTYKLSAHLRHNYLTV 335 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEI RRFQW+FFRVENEWNKM +K +++LS ++IP EEDKLL S +HNV Sbjct: 336 FTITALEIFRRFQWVFFRVENEWNKMNSKSNIQLSMNEIPTEEDKLLASNNHNV 389 >ref|XP_020096304.1| SPX and EXS domain-containing protein 5 isoform X1 [Ananas comosus] Length = 472 Score = 197 bits (500), Expect = 1e-57 Identities = 87/114 (76%), Positives = 106/114 (92%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLS+++R+FKFKNP ++T+ L+G+ W+YYWVIGSNLVLRCTWTYKLSAHLRHNY+TV Sbjct: 355 RDWDLSILSRVFKFKNPSLITSCLYGRIWIYYWVIGSNLVLRCTWTYKLSAHLRHNYITV 414 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F I ALEI+RRFQWIFFRVENEWNKMT+KQ++ELST D+P+EED LL SA+H+V Sbjct: 415 FTIMALEIVRRFQWIFFRVENEWNKMTSKQNIELST-DLPKEEDPLLSSANHSV 467 >ref|XP_010927452.2| PREDICTED: SPX and EXS domain-containing protein 1-like [Elaeis guineensis] Length = 470 Score = 196 bits (499), Expect = 1e-57 Identities = 87/109 (79%), Positives = 101/109 (92%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLSV TRIFKFKNPH+ TNLL+G+ WV+YW+IGSNL+LRCTWTYKLSAHLRHNYLTV Sbjct: 359 RDWDLSVFTRIFKFKNPHLCTNLLYGRIWVFYWMIGSNLILRCTWTYKLSAHLRHNYLTV 418 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGS 220 F ITALEI+RRFQWIFFRVENEWNKMT KQ++ELST +IP+EE+++ S Sbjct: 419 FTITALEILRRFQWIFFRVENEWNKMTAKQNIELSTENIPKEEERVTRS 467 >gb|ONM32884.1| EXS, C-terminal [Zea mays] Length = 189 Score = 187 bits (476), Expect = 2e-57 Identities = 86/114 (75%), Positives = 100/114 (87%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLS++TRIF FKNP I T LL+GQ WV YWV+GSNLVLRCTWTYKLSAHLRHNYLTV Sbjct: 77 RDWDLSILTRIFMFKNPSIWTYLLYGQNWVLYWVLGSNLVLRCTWTYKLSAHLRHNYLTV 136 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F I ALEI+RR+QW+FFRVENEWNKMT KQ++E+S SD+P E D+LL S++H V Sbjct: 137 FTIAALEILRRWQWVFFRVENEWNKMTAKQNMEMS-SDMPSEGDRLLDSSNHTV 189 >ref|XP_015881108.1| PREDICTED: SPX and EXS domain-containing protein 5-like [Ziziphus jujuba] Length = 472 Score = 196 bits (498), Expect = 2e-57 Identities = 84/114 (73%), Positives = 102/114 (89%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWD+S TRIFKF PH+L+NLL+G++WVY+WVIGSNL+LRCTWTYKLSAHLRHNYLTV Sbjct: 359 RDWDMSGFTRIFKFNKPHLLSNLLYGRKWVYFWVIGSNLILRCTWTYKLSAHLRHNYLTV 418 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEI RRFQW+FFRVENEWNKM +K +++L+ DIP+E++KLL S DH+V Sbjct: 419 FTITALEIFRRFQWVFFRVENEWNKMNSKSNIQLTMIDIPKEDEKLLASGDHSV 472 >gb|PON68780.1| EXS, C-terminal [Parasponia andersonii] Length = 390 Score = 193 bits (491), Expect = 3e-57 Identities = 85/114 (74%), Positives = 100/114 (87%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLS TRIFKF H L+NLL+G++WVY+WV+GSNL+LRCTWTYKLSAHLRHNYLTV Sbjct: 277 RDWDLSGFTRIFKFNRTHTLSNLLYGRKWVYFWVLGSNLILRCTWTYKLSAHLRHNYLTV 336 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F ITALEI RRFQW+FFRVENEWNKM +K +++LS ++IP EEDKLL S +HNV Sbjct: 337 FTITALEIFRRFQWVFFRVENEWNKMNSKSNIQLSMNEIPTEEDKLLASNNHNV 390 >gb|ONM01774.1| EXS (ERD1/XPR1/SYG1) family protein [Zea mays] Length = 390 Score = 193 bits (490), Expect = 5e-57 Identities = 88/114 (77%), Positives = 102/114 (89%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLS++TRIF FKNP I TNLL+GQ WV+YWV+GSNLVLRCTWTYKLSAHLRHNYLTV Sbjct: 278 RDWDLSILTRIFMFKNPSIWTNLLYGQNWVFYWVLGSNLVLRCTWTYKLSAHLRHNYLTV 337 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F I ALEI+RR+QW+FFRVENEWNKMT KQ+LE+S SD+P E D+LL S++H V Sbjct: 338 FTIAALEILRRWQWVFFRVENEWNKMTAKQNLEMS-SDMPSEGDRLLDSSNHTV 390 >ref|NP_001334153.1| SPX and EXS domain-containing protein 1-like [Zea mays] gb|ONM01768.1| EXS (ERD1/XPR1/SYG1) family protein [Zea mays] Length = 422 Score = 193 bits (490), Expect = 1e-56 Identities = 88/114 (77%), Positives = 102/114 (89%) Frame = -3 Query: 546 RDWDLSVVTRIFKFKNPHILTNLLFGQRWVYYWVIGSNLVLRCTWTYKLSAHLRHNYLTV 367 RDWDLS++TRIF FKNP I TNLL+GQ WV+YWV+GSNLVLRCTWTYKLSAHLRHNYLTV Sbjct: 310 RDWDLSILTRIFMFKNPSIWTNLLYGQNWVFYWVLGSNLVLRCTWTYKLSAHLRHNYLTV 369 Query: 366 FAITALEIMRRFQWIFFRVENEWNKMTNKQSLELSTSDIPREEDKLLGSADHNV 205 F I ALEI+RR+QW+FFRVENEWNKMT KQ+LE+S SD+P E D+LL S++H V Sbjct: 370 FTIAALEILRRWQWVFFRVENEWNKMTAKQNLEMS-SDMPSEGDRLLDSSNHTV 422