BLASTX nr result
ID: Cheilocostus21_contig00035099
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00035099 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020092781.1| probable inositol transporter 2 [Ananas como... 77 2e-13 gb|OAY69569.1| putative inositol transporter 2 [Ananas comosus] 77 2e-13 ref|XP_009399025.1| PREDICTED: probable inositol transporter 2 [... 75 1e-12 ref|XP_010923820.1| PREDICTED: probable inositol transporter 2 i... 74 2e-12 ref|XP_008794493.1| PREDICTED: probable inositol transporter 2 i... 74 2e-12 gb|KVH89395.1| hypothetical protein Ccrd_008617 [Cynara carduncu... 74 3e-12 ref|XP_023733039.1| probable inositol transporter 2 [Lactuca sat... 74 3e-12 gb|PNX77135.1| putative inositol transporter 2-like protein [Tri... 68 3e-12 dbj|BAF20816.2| Os07g0151200 [Oryza sativa Japonica Group] 72 3e-12 gb|PNX90890.1| putative inositol transporter 2-like protein, par... 68 4e-12 dbj|GAU42288.1| hypothetical protein TSUD_81970, partial [Trifol... 68 4e-12 gb|ONK67315.1| uncharacterized protein A4U43_C06F18870 [Asparagu... 70 1e-11 gb|EEE66574.1| hypothetical protein OsJ_23112 [Oryza sativa Japo... 72 2e-11 ref|XP_015648012.1| PREDICTED: probable inositol transporter 2 [... 72 2e-11 gb|OTG28836.1| putative inositol transporter 2 [Helianthus annuus] 72 2e-11 dbj|GAU42285.1| hypothetical protein TSUD_81940, partial [Trifol... 66 2e-11 ref|XP_022035254.1| probable inositol transporter 2 [Helianthus ... 71 2e-11 ref|XP_018847651.1| PREDICTED: probable inositol transporter 2 [... 71 3e-11 gb|OWM85496.1| hypothetical protein CDL15_Pgr019120 [Punica gran... 71 3e-11 gb|PAN09475.1| hypothetical protein PAHAL_B00306 [Panicum hallii] 71 3e-11 >ref|XP_020092781.1| probable inositol transporter 2 [Ananas comosus] Length = 576 Score = 77.0 bits (188), Expect = 2e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+HEADASAFRECFSL+WR+PYVLRLAFSAGIGG Sbjct: 1 MEGGVHEADASAFRECFSLSWRNPYVLRLAFSAGIGG 37 >gb|OAY69569.1| putative inositol transporter 2 [Ananas comosus] Length = 576 Score = 77.0 bits (188), Expect = 2e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+HEADASAFRECFSL+WR+PYVLRLAFSAGIGG Sbjct: 1 MEGGVHEADASAFRECFSLSWRNPYVLRLAFSAGIGG 37 >ref|XP_009399025.1| PREDICTED: probable inositol transporter 2 [Musa acuminata subsp. malaccensis] Length = 578 Score = 75.1 bits (183), Expect = 1e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+HE D SAFRECFSLAWR+PYVLRLAFSAGIGG Sbjct: 1 MEGGVHEVDGSAFRECFSLAWRNPYVLRLAFSAGIGG 37 >ref|XP_010923820.1| PREDICTED: probable inositol transporter 2 isoform X1 [Elaeis guineensis] Length = 575 Score = 74.3 bits (181), Expect = 2e-12 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+HE DASAF+ECFSL+WR+PYVLRLAFSAGIGG Sbjct: 1 MEGGVHEVDASAFKECFSLSWRNPYVLRLAFSAGIGG 37 >ref|XP_008794493.1| PREDICTED: probable inositol transporter 2 isoform X1 [Phoenix dactylifera] ref|XP_008794494.1| PREDICTED: probable inositol transporter 2 isoform X1 [Phoenix dactylifera] Length = 575 Score = 74.3 bits (181), Expect = 2e-12 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+HE D+SAF+ECFSLAWR+PYVLRLAFSAGIGG Sbjct: 1 MEGGVHEVDSSAFKECFSLAWRNPYVLRLAFSAGIGG 37 >gb|KVH89395.1| hypothetical protein Ccrd_008617 [Cynara cardunculus var. scolymus] Length = 551 Score = 73.9 bits (180), Expect = 3e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGGIH ADASAFR+CFSLAW++PYVLRLAFSAGIGG Sbjct: 1 MEGGIHPADASAFRDCFSLAWKNPYVLRLAFSAGIGG 37 >ref|XP_023733039.1| probable inositol transporter 2 [Lactuca sativa] gb|PLY74566.1| hypothetical protein LSAT_7X27901 [Lactuca sativa] Length = 575 Score = 73.9 bits (180), Expect = 3e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGGIH AD+SAFRECFSLAW++PYVLRLAFSAGIGG Sbjct: 1 MEGGIHPADSSAFRECFSLAWKNPYVLRLAFSAGIGG 37 >gb|PNX77135.1| putative inositol transporter 2-like protein [Trifolium pratense] Length = 69 Score = 68.2 bits (165), Expect = 3e-12 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+ EAD SAFREC SL+W++PYVLRLAFSAGIGG Sbjct: 1 MEGGVPEADVSAFRECLSLSWKNPYVLRLAFSAGIGG 37 >dbj|BAF20816.2| Os07g0151200 [Oryza sativa Japonica Group] Length = 217 Score = 71.6 bits (174), Expect = 3e-12 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+HE D S FRECFSL+WR+PYVLRLAFSAGIGG Sbjct: 1 MEGGVHEFDGSTFRECFSLSWRNPYVLRLAFSAGIGG 37 >gb|PNX90890.1| putative inositol transporter 2-like protein, partial [Trifolium pratense] gb|PNY01048.1| putative inositol transporter 2-like protein, partial [Trifolium pratense] Length = 68 Score = 67.8 bits (164), Expect = 4e-12 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+ EAD SAFREC SL+W++PYVLRLAFSAGIGG Sbjct: 1 MEGGVVEADVSAFRECLSLSWKNPYVLRLAFSAGIGG 37 >dbj|GAU42288.1| hypothetical protein TSUD_81970, partial [Trifolium subterraneum] Length = 68 Score = 67.8 bits (164), Expect = 4e-12 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG EADASAFREC SL+W++PYVLRLAFSAGIGG Sbjct: 1 MEGGAVEADASAFRECLSLSWKNPYVLRLAFSAGIGG 37 >gb|ONK67315.1| uncharacterized protein A4U43_C06F18870 [Asparagus officinalis] Length = 248 Score = 70.5 bits (171), Expect = 1e-11 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+ EADASAF+ECFSL WR+PYVLRLAFSAG+GG Sbjct: 1 MEGGVIEADASAFKECFSLTWRNPYVLRLAFSAGLGG 37 >gb|EEE66574.1| hypothetical protein OsJ_23112 [Oryza sativa Japonica Group] Length = 548 Score = 71.6 bits (174), Expect = 2e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+HE D S FRECFSL+WR+PYVLRLAFSAGIGG Sbjct: 1 MEGGVHEFDGSTFRECFSLSWRNPYVLRLAFSAGIGG 37 >ref|XP_015648012.1| PREDICTED: probable inositol transporter 2 [Oryza sativa Japonica Group] dbj|BAC79509.1| putative proton myo-inositol transporter [Oryza sativa Japonica Group] dbj|BAD31907.1| putative proton myo-inositol transporter [Oryza sativa Japonica Group] dbj|BAT00083.1| Os07g0151200 [Oryza sativa Japonica Group] Length = 596 Score = 71.6 bits (174), Expect = 2e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+HE D S FRECFSL+WR+PYVLRLAFSAGIGG Sbjct: 1 MEGGVHEFDGSTFRECFSLSWRNPYVLRLAFSAGIGG 37 >gb|OTG28836.1| putative inositol transporter 2 [Helianthus annuus] Length = 616 Score = 71.6 bits (174), Expect = 2e-11 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = +3 Query: 372 LMEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 +MEGG+H ADAS+F++CFSLAW++PYVLRLAFSAGIGG Sbjct: 34 VMEGGVHPADASSFKDCFSLAWKNPYVLRLAFSAGIGG 71 >dbj|GAU42285.1| hypothetical protein TSUD_81940, partial [Trifolium subterraneum] Length = 68 Score = 65.9 bits (159), Expect = 2e-11 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+ +AD SAFREC SL+W++PY+LRLAFSAGIGG Sbjct: 1 MEGGVPKADISAFRECLSLSWKNPYILRLAFSAGIGG 37 >ref|XP_022035254.1| probable inositol transporter 2 [Helianthus annuus] Length = 582 Score = 71.2 bits (173), Expect = 2e-11 Identities = 30/37 (81%), Positives = 36/37 (97%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+H ADAS+F++CFSLAW++PYVLRLAFSAGIGG Sbjct: 1 MEGGVHPADASSFKDCFSLAWKNPYVLRLAFSAGIGG 37 >ref|XP_018847651.1| PREDICTED: probable inositol transporter 2 [Juglans regia] Length = 578 Score = 70.9 bits (172), Expect = 3e-11 Identities = 33/38 (86%), Positives = 37/38 (97%), Gaps = 1/38 (2%) Frame = +3 Query: 375 MEGGIH-EADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+H EAD+SAFRECFSLAW++PYVLRLAFSAGIGG Sbjct: 1 MEGGLHIEADSSAFRECFSLAWKNPYVLRLAFSAGIGG 38 >gb|OWM85496.1| hypothetical protein CDL15_Pgr019120 [Punica granatum] gb|PKI31829.1| hypothetical protein CRG98_047780 [Punica granatum] Length = 579 Score = 70.9 bits (172), Expect = 3e-11 Identities = 34/39 (87%), Positives = 36/39 (92%), Gaps = 2/39 (5%) Frame = +3 Query: 375 MEGGIH--EADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGGIH EADASAFRECFSL W++PYVLRLAFSAGIGG Sbjct: 1 MEGGIHPGEADASAFRECFSLTWKNPYVLRLAFSAGIGG 39 >gb|PAN09475.1| hypothetical protein PAHAL_B00306 [Panicum hallii] Length = 592 Score = 70.9 bits (172), Expect = 3e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 375 MEGGIHEADASAFRECFSLAWRHPYVLRLAFSAGIGG 485 MEGG+HE D S F+ECFSL+WR+PYVLRLAFSAGIGG Sbjct: 1 MEGGVHELDGSTFKECFSLSWRNPYVLRLAFSAGIGG 37