BLASTX nr result
ID: Cheilocostus21_contig00034875
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00034875 (1105 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009418132.1| PREDICTED: formin-like protein 6 isoform X3 ... 64 3e-07 ref|XP_018686795.1| PREDICTED: formin-like protein 6 isoform X2 ... 64 3e-07 ref|XP_018686792.1| PREDICTED: formin-like protein 6 isoform X1 ... 64 3e-07 >ref|XP_009418132.1| PREDICTED: formin-like protein 6 isoform X3 [Musa acuminata subsp. malaccensis] Length = 1048 Score = 63.9 bits (154), Expect = 3e-07 Identities = 35/47 (74%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = +3 Query: 3 PASRSTPALSSNYRS--HATGSRYHSAPSALGIMALLDDHAACDSTE 137 PASRSTP SSN S H T SRYHSAPSALGIMALL DHA DS+E Sbjct: 239 PASRSTPVFSSNSLSGSHVTVSRYHSAPSALGIMALLHDHAEPDSSE 285 >ref|XP_018686795.1| PREDICTED: formin-like protein 6 isoform X2 [Musa acuminata subsp. malaccensis] Length = 1109 Score = 63.9 bits (154), Expect = 3e-07 Identities = 35/47 (74%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = +3 Query: 3 PASRSTPALSSNYRS--HATGSRYHSAPSALGIMALLDDHAACDSTE 137 PASRSTP SSN S H T SRYHSAPSALGIMALL DHA DS+E Sbjct: 486 PASRSTPVFSSNSLSGSHVTVSRYHSAPSALGIMALLHDHAEPDSSE 532 >ref|XP_018686792.1| PREDICTED: formin-like protein 6 isoform X1 [Musa acuminata subsp. malaccensis] Length = 1295 Score = 63.9 bits (154), Expect = 3e-07 Identities = 35/47 (74%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = +3 Query: 3 PASRSTPALSSNYRS--HATGSRYHSAPSALGIMALLDDHAACDSTE 137 PASRSTP SSN S H T SRYHSAPSALGIMALL DHA DS+E Sbjct: 486 PASRSTPVFSSNSLSGSHVTVSRYHSAPSALGIMALLHDHAEPDSSE 532