BLASTX nr result
ID: Cheilocostus21_contig00034864
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00034864 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009405169.1| PREDICTED: transcription factor GTE4 [Musa a... 57 1e-06 >ref|XP_009405169.1| PREDICTED: transcription factor GTE4 [Musa acuminata subsp. malaccensis] Length = 644 Score = 57.0 bits (136), Expect = 1e-06 Identities = 36/71 (50%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Frame = +2 Query: 212 AAAGPGDGIGE-RRLSELKVYTRRNRGKNNPPETADHTPQPSSFETLIXXXXXXXXXXDL 388 AAA GDGI E RR ELKVY+RR RGKN P A + PQPSS ETL L Sbjct: 10 AAADDGDGISETRRTPELKVYSRRRRGKNTPAADAQN-PQPSSRETLATTTTTGDVDSSL 68 Query: 389 HASQAKLPSPP 421 PSPP Sbjct: 69 QQPPPPPPSPP 79