BLASTX nr result
ID: Cheilocostus21_contig00034758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00034758 (578 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY05306.1| ion peptidase N-terminal domain and RING finger p... 57 3e-07 dbj|GAU33044.1| hypothetical protein TSUD_151990 [Trifolium subt... 57 3e-06 ref|XP_013459406.1| zinc finger, C3HC4 type (RING finger) protei... 57 4e-06 ref|XP_013459405.1| zinc finger, C3HC4 type (RING finger) protei... 57 4e-06 >gb|PNY05306.1| ion peptidase N-terminal domain and RING finger protein 1 [Trifolium pratense] Length = 125 Score = 57.4 bits (137), Expect = 3e-07 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 213 IWVEGRRQFRNFRSWDQAVYCAAEVEWIRDILPRKGPKKE 94 I +EGRR+FRN RSWDQ Y AEVEWI+DI+P +G K++ Sbjct: 41 IEIEGRRRFRNLRSWDQDGYRVAEVEWIQDIMPPEGTKEK 80 >dbj|GAU33044.1| hypothetical protein TSUD_151990 [Trifolium subterraneum] Length = 444 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 213 IWVEGRRQFRNFRSWDQAVYCAAEVEWIRDILPRKGPKKE 94 I +EGRR+FRN RSWDQ Y AEVEWI+DI+P +G K++ Sbjct: 362 IEIEGRRRFRNLRSWDQDGYRVAEVEWIQDIMPPEGTKEK 401 >ref|XP_013459406.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] gb|KEH33437.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] Length = 433 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 213 IWVEGRRQFRNFRSWDQAVYCAAEVEWIRDILPRKGPKK 97 I +EGRR+FRN RSWDQ Y AEVEWI+DI+P +G K+ Sbjct: 298 IEIEGRRRFRNLRSWDQDGYRVAEVEWIQDIMPPEGTKE 336 >ref|XP_013459405.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] gb|KEH33436.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] Length = 480 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 213 IWVEGRRQFRNFRSWDQAVYCAAEVEWIRDILPRKGPKK 97 I +EGRR+FRN RSWDQ Y AEVEWI+DI+P +G K+ Sbjct: 345 IEIEGRRRFRNLRSWDQDGYRVAEVEWIQDIMPPEGTKE 383