BLASTX nr result
ID: Cheilocostus21_contig00034528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00034528 (851 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009387794.1| PREDICTED: uncharacterized protein LOC103974... 74 1e-11 >ref|XP_009387794.1| PREDICTED: uncharacterized protein LOC103974649, partial [Musa acuminata subsp. malaccensis] Length = 265 Score = 73.9 bits (180), Expect = 1e-11 Identities = 43/71 (60%), Positives = 51/71 (71%), Gaps = 2/71 (2%) Frame = -1 Query: 209 MAQVAVIESSSNSLMFGTSKPVMTMKRKTPSELRREQLKRSSQKV--TKILPPLPISDSV 36 MAQ AV+ES+SNSL G + MT KRKTPSELR EQLKR + +V K LPPL SDSV Sbjct: 1 MAQAAVVESTSNSLPPGAANSGMTKKRKTPSELRGEQLKRRNAQVIGEKTLPPLLASDSV 60 Query: 35 KVDEIKRCEQV 3 K + I+R EQ+ Sbjct: 61 KSNAIRRSEQL 71