BLASTX nr result
ID: Cheilocostus21_contig00034250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00034250 (643 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009387499.1| PREDICTED: uncharacterized protein At2g39795... 58 2e-06 ref|XP_008796210.1| PREDICTED: uncharacterized protein At2g39795... 57 5e-06 ref|XP_010927302.1| PREDICTED: uncharacterized protein At2g39795... 57 5e-06 >ref|XP_009387499.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial [Musa acuminata subsp. malaccensis] Length = 262 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 643 SLFDFLHEYMLQKDEREYLAWLQNIKKFVA 554 SLFDFLHEYML KDEREYL WL+N+K+FVA Sbjct: 232 SLFDFLHEYMLAKDEREYLTWLKNMKEFVA 261 >ref|XP_008796210.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial-like [Phoenix dactylifera] Length = 263 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -1 Query: 643 SLFDFLHEYMLQKDEREYLAWLQNIKKFV 557 SLFDFLHEYM+ KDE+EYLAWL+N+K+FV Sbjct: 233 SLFDFLHEYMMSKDEKEYLAWLKNLKEFV 261 >ref|XP_010927302.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial [Elaeis guineensis] Length = 264 Score = 56.6 bits (135), Expect = 5e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -1 Query: 643 SLFDFLHEYMLQKDEREYLAWLQNIKKFV 557 SLFDFLHEYM+ KDE+EYLAWL+N+K+FV Sbjct: 234 SLFDFLHEYMMNKDEKEYLAWLKNLKEFV 262