BLASTX nr result
ID: Cheilocostus21_contig00034024
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00034024 (537 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022150004.1| uncharacterized protein LOC111018282, partia... 57 2e-06 >ref|XP_022150004.1| uncharacterized protein LOC111018282, partial [Momordica charantia] Length = 501 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/71 (46%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Frame = +1 Query: 1 KRQYARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXIQLPLQ-RGLWVPGGNHFPESALKS 177 KRQYARQ Q+ LQ +GLWVPGGNHFPESALKS Sbjct: 430 KRQYARQVAEFFAFVKKKNEASSSTAGQDGSNGCQPQVMLQNKGLWVPGGNHFPESALKS 489 Query: 178 LDLKGAMSFLS 210 LD + AMS++S Sbjct: 490 LDFRRAMSYMS 500