BLASTX nr result
ID: Cheilocostus21_contig00033953
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00033953 (553 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFF18843.1| gamma-glutamylcysteine synthetase, partial [Dimoc... 113 2e-29 ref|XP_019264662.1| PREDICTED: glutamate--cysteine ligase, chlor... 120 2e-28 ref|NP_001312610.1| glutamate--cysteine ligase, chloroplastic [N... 120 2e-28 gb|OMO79518.1| Glutamate--cysteine ligase, GCS2 [Corchorus capsu... 119 4e-28 gb|OMO58643.1| Glutamate--cysteine ligase, GCS2 [Corchorus olito... 119 4e-28 ref|XP_020276554.1| glutamate--cysteine ligase, chloroplastic [A... 119 5e-28 ref|XP_016460741.1| PREDICTED: glutamate--cysteine ligase, chlor... 119 6e-28 ref|XP_009617977.1| PREDICTED: glutamate--cysteine ligase, chlor... 119 6e-28 ref|XP_017698922.1| PREDICTED: glutamate--cysteine ligase, chlor... 118 8e-28 ref|XP_010937863.1| PREDICTED: glutamate--cysteine ligase A, chl... 118 8e-28 ref|XP_008792987.1| PREDICTED: glutamate--cysteine ligase, chlor... 118 8e-28 dbj|BAD27390.1| gamma-glutamylcysteine synthetase [Zinnia violacea] 118 8e-28 gb|ONK62683.1| uncharacterized protein A4U43_C07F6880 [Asparagus... 119 9e-28 ref|XP_020086069.1| glutamate--cysteine ligase, chloroplastic [A... 118 9e-28 gb|OAY82206.1| Glutamate--cysteine ligase, chloroplastic [Ananas... 118 1e-27 ref|XP_010920822.1| PREDICTED: glutamate--cysteine ligase, chlor... 118 1e-27 gb|PON84591.1| Glutamate--cysteine ligase [Trema orientalis] 118 1e-27 gb|AFP93564.1| GCS [Cestrum nocturnum] 117 2e-27 ref|XP_022845500.1| glutamate--cysteine ligase, chloroplastic-li... 117 2e-27 gb|OTF84860.1| putative glutamate--cysteine ligase protein [Heli... 117 2e-27 >gb|AFF18843.1| gamma-glutamylcysteine synthetase, partial [Dimocarpus longan] Length = 78 Score = 113 bits (282), Expect = 2e-29 Identities = 51/65 (78%), Positives = 60/65 (92%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVA++++KLAK GLERRG+KE+GFLN V E+ RTG+TPAEKLLE+YHGKWG SVDPVF Sbjct: 14 LRHVAQDILKLAKDGLERRGFKESGFLNAVAEVVRTGVTPAEKLLEMYHGKWGQSVDPVF 73 Query: 371 EELLY 357 EELLY Sbjct: 74 EELLY 78 >ref|XP_019264662.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana attenuata] gb|OIT36259.1| glutamate--cysteine ligase, chloroplastic [Nicotiana attenuata] Length = 522 Score = 120 bits (300), Expect = 2e-28 Identities = 56/65 (86%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 L+HVA++VVKLAK GLERRGYKE GFLNEVTE+ RTG+TPAEKLLELYHGKWG SVDPVF Sbjct: 458 LKHVAQDVVKLAKEGLERRGYKETGFLNEVTEVVRTGVTPAEKLLELYHGKWGRSVDPVF 517 Query: 371 EELLY 357 EELLY Sbjct: 518 EELLY 522 >ref|NP_001312610.1| glutamate--cysteine ligase, chloroplastic [Nicotiana tabacum] ref|XP_009766955.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana sylvestris] ref|XP_016478566.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana tabacum] sp|Q1W2L8.2|GSH1_TOBAC RecName: Full=Glutamate--cysteine ligase, chloroplastic; AltName: Full=Gamma-ECS; Short=GCS; AltName: Full=Gamma-glutamylcysteine synthetase; Flags: Precursor gb|ABD98695.2| chloroplast gamma-glutamylcysteine synthetase [Nicotiana tabacum] Length = 522 Score = 120 bits (300), Expect = 2e-28 Identities = 56/65 (86%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 L+HVA++VVKLAK GLERRGYKE GFLNEVTE+ RTG+TPAEKLLELYHGKWG SVDPVF Sbjct: 458 LKHVAQDVVKLAKEGLERRGYKETGFLNEVTEVVRTGVTPAEKLLELYHGKWGRSVDPVF 517 Query: 371 EELLY 357 EELLY Sbjct: 518 EELLY 522 >gb|OMO79518.1| Glutamate--cysteine ligase, GCS2 [Corchorus capsularis] Length = 522 Score = 119 bits (298), Expect = 4e-28 Identities = 56/65 (86%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVAE+V+KLAK GLERRGYKE+GFLNEV E+ RTG+TPAEKLLELYHGKWG SVDPVF Sbjct: 458 LRHVAEDVLKLAKDGLERRGYKESGFLNEVAEVVRTGVTPAEKLLELYHGKWGQSVDPVF 517 Query: 371 EELLY 357 EELLY Sbjct: 518 EELLY 522 >gb|OMO58643.1| Glutamate--cysteine ligase, GCS2 [Corchorus olitorius] Length = 522 Score = 119 bits (298), Expect = 4e-28 Identities = 56/65 (86%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVAE+V+KLAK GLERRGYKE+GFLNEV E+ RTG+TPAEKLLELYHGKWG SVDPVF Sbjct: 458 LRHVAEDVLKLAKDGLERRGYKESGFLNEVAEVVRTGVTPAEKLLELYHGKWGQSVDPVF 517 Query: 371 EELLY 357 EELLY Sbjct: 518 EELLY 522 >ref|XP_020276554.1| glutamate--cysteine ligase, chloroplastic [Asparagus officinalis] Length = 503 Score = 119 bits (297), Expect = 5e-28 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVAE+V+KLAK GLERRGYKEAGFL EV E+ ++G+TPAEKLLELYHGKWGGSVDPVF Sbjct: 439 LRHVAEDVLKLAKDGLERRGYKEAGFLREVAEVVKSGITPAEKLLELYHGKWGGSVDPVF 498 Query: 371 EELLY 357 EELLY Sbjct: 499 EELLY 503 >ref|XP_016460741.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Nicotiana tabacum] Length = 522 Score = 119 bits (297), Expect = 6e-28 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 L+HVA++VVKLAK GLERRGYKE GFLNEVTE+ +TG+TPAEKLLELYHGKWG SVDPVF Sbjct: 458 LKHVAQDVVKLAKEGLERRGYKETGFLNEVTEVVKTGVTPAEKLLELYHGKWGRSVDPVF 517 Query: 371 EELLY 357 EELLY Sbjct: 518 EELLY 522 >ref|XP_009617977.1| PREDICTED: glutamate--cysteine ligase, chloroplastic [Nicotiana tomentosiformis] Length = 522 Score = 119 bits (297), Expect = 6e-28 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 L+HVA++VVKLAK GLERRGYKE GFLNEVTE+ +TG+TPAEKLLELYHGKWG SVDPVF Sbjct: 458 LKHVAQDVVKLAKEGLERRGYKETGFLNEVTEVVKTGVTPAEKLLELYHGKWGRSVDPVF 517 Query: 371 EELLY 357 EELLY Sbjct: 518 EELLY 522 >ref|XP_017698922.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform X2 [Phoenix dactylifera] Length = 515 Score = 118 bits (296), Expect = 8e-28 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVAE+V+KLAK GLERR YKEAGFLNEVTE+ RTG+TPAEKLLELYHGKWG SVDPVF Sbjct: 451 LRHVAEDVLKLAKDGLERRCYKEAGFLNEVTEVVRTGVTPAEKLLELYHGKWGCSVDPVF 510 Query: 371 EELLY 357 EELLY Sbjct: 511 EELLY 515 >ref|XP_010937863.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Elaeis guineensis] ref|XP_010937864.1| PREDICTED: glutamate--cysteine ligase A, chloroplastic-like [Elaeis guineensis] Length = 522 Score = 118 bits (296), Expect = 8e-28 Identities = 57/65 (87%), Positives = 60/65 (92%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVAEEV+KLAK GLERRGYKEAGFL EVTE+ TG+TPAEKLLELYHGKWG SVDPVF Sbjct: 458 LRHVAEEVLKLAKDGLERRGYKEAGFLKEVTEVVSTGVTPAEKLLELYHGKWGCSVDPVF 517 Query: 371 EELLY 357 EELLY Sbjct: 518 EELLY 522 >ref|XP_008792987.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform X1 [Phoenix dactylifera] ref|XP_008792991.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform X1 [Phoenix dactylifera] ref|XP_008792999.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform X1 [Phoenix dactylifera] ref|XP_008793008.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like isoform X1 [Phoenix dactylifera] Length = 522 Score = 118 bits (296), Expect = 8e-28 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVAE+V+KLAK GLERR YKEAGFLNEVTE+ RTG+TPAEKLLELYHGKWG SVDPVF Sbjct: 458 LRHVAEDVLKLAKDGLERRCYKEAGFLNEVTEVVRTGVTPAEKLLELYHGKWGCSVDPVF 517 Query: 371 EELLY 357 EELLY Sbjct: 518 EELLY 522 >dbj|BAD27390.1| gamma-glutamylcysteine synthetase [Zinnia violacea] Length = 523 Score = 118 bits (296), Expect = 8e-28 Identities = 56/65 (86%), Positives = 59/65 (90%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 L+HVAEEV+K AK GLERRGYKE GFLNEV E+ RTGLTPAEKLLELYHGKWG SVDPVF Sbjct: 459 LKHVAEEVLKFAKDGLERRGYKETGFLNEVAEVVRTGLTPAEKLLELYHGKWGQSVDPVF 518 Query: 371 EELLY 357 EELLY Sbjct: 519 EELLY 523 >gb|ONK62683.1| uncharacterized protein A4U43_C07F6880 [Asparagus officinalis] Length = 599 Score = 119 bits (297), Expect = 9e-28 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVAE+V+KLAK GLERRGYKEAGFL EV E+ ++G+TPAEKLLELYHGKWGGSVDPVF Sbjct: 535 LRHVAEDVLKLAKDGLERRGYKEAGFLREVAEVVKSGITPAEKLLELYHGKWGGSVDPVF 594 Query: 371 EELLY 357 EELLY Sbjct: 595 EELLY 599 >ref|XP_020086069.1| glutamate--cysteine ligase, chloroplastic [Ananas comosus] Length = 496 Score = 118 bits (295), Expect = 9e-28 Identities = 55/65 (84%), Positives = 60/65 (92%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVAE+V+ ++K GLERRGYKE GFL EVTEI RTG+TPAEKLLELYHGKWGGSVDPVF Sbjct: 432 LRHVAEDVLNMSKDGLERRGYKETGFLKEVTEIVRTGVTPAEKLLELYHGKWGGSVDPVF 491 Query: 371 EELLY 357 EELLY Sbjct: 492 EELLY 496 >gb|OAY82206.1| Glutamate--cysteine ligase, chloroplastic [Ananas comosus] Length = 515 Score = 118 bits (295), Expect = 1e-27 Identities = 55/65 (84%), Positives = 60/65 (92%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVAE+V+ ++K GLERRGYKE GFL EVTEI RTG+TPAEKLLELYHGKWGGSVDPVF Sbjct: 451 LRHVAEDVLNMSKDGLERRGYKETGFLKEVTEIVRTGVTPAEKLLELYHGKWGGSVDPVF 510 Query: 371 EELLY 357 EELLY Sbjct: 511 EELLY 515 >ref|XP_010920822.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Elaeis guineensis] ref|XP_010920823.1| PREDICTED: glutamate--cysteine ligase, chloroplastic-like [Elaeis guineensis] Length = 523 Score = 118 bits (295), Expect = 1e-27 Identities = 56/65 (86%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVAE+V+KLAK GLERR YKEAGFLNEVTE+ RTG+TPAEKLLELYHGKWG SVDPVF Sbjct: 459 LRHVAEDVLKLAKDGLERRSYKEAGFLNEVTEVVRTGVTPAEKLLELYHGKWGCSVDPVF 518 Query: 371 EELLY 357 +ELLY Sbjct: 519 KELLY 523 >gb|PON84591.1| Glutamate--cysteine ligase [Trema orientalis] Length = 532 Score = 118 bits (295), Expect = 1e-27 Identities = 55/65 (84%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 LRHVAE+V+KLAK GLERRG+KE+GFLNEV E+ RTG+TPAEKLLELYHGKWG SVDPVF Sbjct: 468 LRHVAEDVLKLAKDGLERRGFKESGFLNEVAEVVRTGITPAEKLLELYHGKWGQSVDPVF 527 Query: 371 EELLY 357 EELLY Sbjct: 528 EELLY 532 >gb|AFP93564.1| GCS [Cestrum nocturnum] Length = 518 Score = 117 bits (294), Expect = 2e-27 Identities = 54/65 (83%), Positives = 61/65 (93%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 L+HVA++V+KLAK GLERRGYKE GFLNEVTE+ RTG+TPAEKLL+LYHGKWG SVDPVF Sbjct: 454 LKHVAQDVMKLAKEGLERRGYKETGFLNEVTEVVRTGVTPAEKLLDLYHGKWGQSVDPVF 513 Query: 371 EELLY 357 EELLY Sbjct: 514 EELLY 518 >ref|XP_022845500.1| glutamate--cysteine ligase, chloroplastic-like [Olea europaea var. sylvestris] Length = 526 Score = 117 bits (294), Expect = 2e-27 Identities = 55/65 (84%), Positives = 60/65 (92%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 L+HVA+EVVKLAK GLERRGYKE GFLNE+ E+ RTG+TPAEKLLELYHGKWG SVDPVF Sbjct: 462 LKHVAQEVVKLAKDGLERRGYKETGFLNEMNEVVRTGVTPAEKLLELYHGKWGQSVDPVF 521 Query: 371 EELLY 357 EELLY Sbjct: 522 EELLY 526 >gb|OTF84860.1| putative glutamate--cysteine ligase protein [Helianthus annuus] Length = 520 Score = 117 bits (293), Expect = 2e-27 Identities = 55/65 (84%), Positives = 60/65 (92%) Frame = -3 Query: 551 LRHVAEEVVKLAKAGLERRGYKEAGFLNEVTEIARTGLTPAEKLLELYHGKWGGSVDPVF 372 L+HVAEEV++LAK GLERRGYKE GFLNEV E+ RTGLTPAEKLLELYHGKWG +VDPVF Sbjct: 456 LKHVAEEVLQLAKDGLERRGYKETGFLNEVAEVVRTGLTPAEKLLELYHGKWGQNVDPVF 515 Query: 371 EELLY 357 EELLY Sbjct: 516 EELLY 520