BLASTX nr result
ID: Cheilocostus21_contig00033761
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00033761 (729 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI70061.1| hypothetical protein CRG98_009524 [Punica granatum] 56 2e-06 ref|XP_018684469.1| PREDICTED: anthocyanin regulatory C1 protein... 58 2e-06 ref|XP_018684468.1| PREDICTED: myb-related protein 308-like isof... 58 3e-06 ref|XP_012077551.1| transcription factor WER [Jatropha curcas] >... 56 7e-06 gb|KDP34036.1| hypothetical protein JCGZ_07607 [Jatropha curcas] 56 7e-06 ref|XP_008784295.1| PREDICTED: transcription factor MYB23-like [... 57 8e-06 >gb|PKI70061.1| hypothetical protein CRG98_009524 [Punica granatum] Length = 124 Score = 55.8 bits (133), Expect = 2e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -1 Query: 729 GRLPGRTDNEIKNYWNTVLKKKLNARPHK 643 GRLPGRTDNEIKNYWNTVLKKKL ++ K Sbjct: 94 GRLPGRTDNEIKNYWNTVLKKKLKSKEQK 122 >ref|XP_018684469.1| PREDICTED: anthocyanin regulatory C1 protein-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 231 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 729 GRLPGRTDNEIKNYWNTVLKKKLNARP 649 GRLPGRTDNEIKNYWNTVLKKKL A+P Sbjct: 94 GRLPGRTDNEIKNYWNTVLKKKLQAQP 120 >ref|XP_018684468.1| PREDICTED: myb-related protein 308-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 269 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -1 Query: 729 GRLPGRTDNEIKNYWNTVLKKKLNARP 649 GRLPGRTDNEIKNYWNTVLKKKL A+P Sbjct: 94 GRLPGRTDNEIKNYWNTVLKKKLQAQP 120 >ref|XP_012077551.1| transcription factor WER [Jatropha curcas] gb|AIT52267.1| MYB family protein [Jatropha curcas] Length = 222 Score = 56.2 bits (134), Expect = 7e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -1 Query: 729 GRLPGRTDNEIKNYWNTVLKKKLNARPHKDRV 634 GRLPGRTDNEIKNYWN+ LKKK++ + HK ++ Sbjct: 94 GRLPGRTDNEIKNYWNSTLKKKIDKKQHKKKI 125 >gb|KDP34036.1| hypothetical protein JCGZ_07607 [Jatropha curcas] Length = 222 Score = 56.2 bits (134), Expect = 7e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -1 Query: 729 GRLPGRTDNEIKNYWNTVLKKKLNARPHKDRV 634 GRLPGRTDNEIKNYWN+ LKKK++ + HK ++ Sbjct: 94 GRLPGRTDNEIKNYWNSTLKKKIDKKQHKKKI 125 >ref|XP_008784295.1| PREDICTED: transcription factor MYB23-like [Phoenix dactylifera] Length = 281 Score = 56.6 bits (135), Expect = 8e-06 Identities = 27/37 (72%), Positives = 29/37 (78%), Gaps = 2/37 (5%) Frame = -1 Query: 729 GRLPGRTDNEIKNYWNTVLKKKLNAR--PHKDRVCSN 625 GRLPGRTDNEIKNYWNTVLKKK R P + +CSN Sbjct: 94 GRLPGRTDNEIKNYWNTVLKKKAQVRSVPLTNLMCSN 130