BLASTX nr result
ID: Cheilocostus21_contig00033685
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00033685 (559 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009393845.1| PREDICTED: metal transporter Nramp2 [Musa ac... 59 1e-06 >ref|XP_009393845.1| PREDICTED: metal transporter Nramp2 [Musa acuminata subsp. malaccensis] Length = 516 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = -1 Query: 556 EVHGLLITFFLSLALVLYMMFIIYLVLRGATFCSSLTSAIKKGFSN 419 EVHGLLI+ LS AL +Y++FI YLVLR + FC+S T AI KGF N Sbjct: 469 EVHGLLISCLLSSALAIYVIFIAYLVLRHSAFCTSGTLAINKGFCN 514