BLASTX nr result
ID: Cheilocostus21_contig00033512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00033512 (580 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB83644.1| PIF-like transposase [Daucus carota] 56 1e-07 >gb|ABB83644.1| PIF-like transposase [Daucus carota] Length = 425 Score = 56.2 bits (134), Expect(2) = 1e-07 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -3 Query: 422 SDEFWEIIQHTSIVVDKYFLTSLHKRPCMVSDYTGMRWMEEILG-HPEQCKM 270 +DEFW++I T+ + +Y+ T +HK PCM S TG RWM+EIL + +CK+ Sbjct: 41 TDEFWDLIVCTTAAITEYYCTFIHKVPCMTSYQTGHRWMQEILSMNANRCKI 92 Score = 27.3 bits (59), Expect(2) = 1e-07 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -1 Query: 283 NNVR*MMRMEQHDFFQLCTTLENETKLEKLSDWSKLNK 170 N + M RME+ FFQL LEN +L+ S + K Sbjct: 88 NRCKIMFRMEKETFFQLSRDLENIYELKPSRRMSVIEK 125