BLASTX nr result
ID: Cheilocostus21_contig00033349
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00033349 (571 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017702045.1| PREDICTED: shaggy-related protein kinase alp... 56 1e-06 ref|XP_017702047.1| PREDICTED: shaggy-related protein kinase alp... 56 1e-06 >ref|XP_017702045.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X1 [Phoenix dactylifera] Length = 137 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 570 ELKGVPMEVVAKLIPEHDRKQCAFLGL*VGRQ 475 ELKGVPME++AKLIPEH RKQCAFLGL RQ Sbjct: 96 ELKGVPMEILAKLIPEHARKQCAFLGLLFARQ 127 >ref|XP_017702047.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 [Phoenix dactylifera] Length = 139 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -2 Query: 570 ELKGVPMEVVAKLIPEHDRKQCAFLGL*VGRQ 475 ELKGVPME++AKLIPEH RKQCAFLGL RQ Sbjct: 98 ELKGVPMEILAKLIPEHARKQCAFLGLLFARQ 129