BLASTX nr result
ID: Cheilocostus21_contig00032939
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00032939 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301361.2| hypothetical protein POPTR_0002s16200g [Popu... 67 1e-11 ref|XP_018505405.1| PREDICTED: ascorbate transporter, chloroplas... 70 4e-11 ref|XP_009367842.1| PREDICTED: ascorbate transporter, chloroplas... 70 4e-11 ref|XP_008342264.1| PREDICTED: ascorbate transporter, chloroplas... 70 4e-11 gb|ABN08856.1| Putative transporter C20orf59 homolog, related [M... 67 7e-11 ref|XP_008338836.1| PREDICTED: ascorbate transporter, chloroplas... 69 8e-11 ref|XP_023539310.1| ascorbate transporter, chloroplastic-like [C... 69 8e-11 ref|XP_022974609.1| ascorbate transporter, chloroplastic-like [C... 69 8e-11 ref|XP_022949320.1| ascorbate transporter, chloroplastic-like [C... 69 8e-11 ref|XP_008338835.1| PREDICTED: ascorbate transporter, chloroplas... 69 8e-11 gb|AQK95874.1| Ascorbate transporter chloroplastic [Zea mays] 68 1e-10 ref|XP_010670194.1| PREDICTED: ascorbate transporter, chloroplas... 69 1e-10 ref|XP_003594358.2| anion transporter 4 [Medicago truncatula] >g... 67 1e-10 gb|ONM41477.1| Ascorbate transporter chloroplastic [Zea mays] 68 1e-10 gb|EMS64245.1| putative anion transporter 4, chloroplastic [Trit... 68 1e-10 gb|OEL29965.1| Ascorbate transporter, chloroplastic [Dichantheli... 68 1e-10 ref|XP_015611821.1| PREDICTED: probable anion transporter 4, chl... 68 2e-10 gb|PAN11022.1| hypothetical protein PAHAL_B01943 [Panicum hallii] 68 2e-10 ref|XP_004956239.1| probable anion transporter 4, chloroplastic ... 68 2e-10 ref|XP_002457997.2| probable anion transporter 4, chloroplastic ... 68 2e-10 >ref|XP_002301361.2| hypothetical protein POPTR_0002s16200g [Populus trichocarpa] Length = 132 Score = 67.4 bits (163), Expect = 1e-11 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 314 VRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 54 VLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 90 >ref|XP_018505405.1| PREDICTED: ascorbate transporter, chloroplastic-like isoform X2 [Pyrus x bretschneideri] Length = 575 Score = 69.7 bits (169), Expect = 4e-11 Identities = 38/54 (70%), Positives = 39/54 (72%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P LLSRV V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 469 PAFSLTLLSRVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 522 >ref|XP_009367842.1| PREDICTED: ascorbate transporter, chloroplastic-like isoform X1 [Pyrus x bretschneideri] Length = 610 Score = 69.7 bits (169), Expect = 4e-11 Identities = 38/54 (70%), Positives = 39/54 (72%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P LLSRV V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 504 PAFSLTLLSRVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 557 >ref|XP_008342264.1| PREDICTED: ascorbate transporter, chloroplastic-like [Malus domestica] Length = 610 Score = 69.7 bits (169), Expect = 4e-11 Identities = 38/54 (70%), Positives = 39/54 (72%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P LLSRV V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 504 PAFSLTLLSRVKTPXMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 557 >gb|ABN08856.1| Putative transporter C20orf59 homolog, related [Medicago truncatula] Length = 210 Score = 67.4 bits (163), Expect = 7e-11 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 314 VRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 130 VLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 166 >ref|XP_008338836.1| PREDICTED: ascorbate transporter, chloroplastic-like isoform X2 [Malus domestica] Length = 573 Score = 68.9 bits (167), Expect = 8e-11 Identities = 37/48 (77%), Positives = 38/48 (79%), Gaps = 5/48 (10%) Frame = +2 Query: 296 LLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 LLSRV V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 473 LLSRVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 520 >ref|XP_023539310.1| ascorbate transporter, chloroplastic-like [Cucurbita pepo subsp. pepo] ref|XP_023539311.1| ascorbate transporter, chloroplastic-like [Cucurbita pepo subsp. pepo] Length = 600 Score = 68.9 bits (167), Expect = 8e-11 Identities = 37/48 (77%), Positives = 38/48 (79%), Gaps = 5/48 (10%) Frame = +2 Query: 296 LLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 LLSRV V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 500 LLSRVRTPAMAVLCMACCQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 547 >ref|XP_022974609.1| ascorbate transporter, chloroplastic-like [Cucurbita maxima] Length = 600 Score = 68.9 bits (167), Expect = 8e-11 Identities = 37/48 (77%), Positives = 38/48 (79%), Gaps = 5/48 (10%) Frame = +2 Query: 296 LLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 LLSRV V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 500 LLSRVRTPAMAVLCMACCQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 547 >ref|XP_022949320.1| ascorbate transporter, chloroplastic-like [Cucurbita moschata] Length = 600 Score = 68.9 bits (167), Expect = 8e-11 Identities = 37/48 (77%), Positives = 38/48 (79%), Gaps = 5/48 (10%) Frame = +2 Query: 296 LLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 LLSRV V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 500 LLSRVRTPAMAVLCMACCQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 547 >ref|XP_008338835.1| PREDICTED: ascorbate transporter, chloroplastic-like isoform X1 [Malus domestica] Length = 608 Score = 68.9 bits (167), Expect = 8e-11 Identities = 37/48 (77%), Positives = 38/48 (79%), Gaps = 5/48 (10%) Frame = +2 Query: 296 LLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 LLSRV V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 508 LLSRVKTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 555 >gb|AQK95874.1| Ascorbate transporter chloroplastic [Zea mays] Length = 308 Score = 68.2 bits (165), Expect = 1e-10 Identities = 37/54 (68%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P + LLS+V V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 202 PALFLTLLSKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 255 >ref|XP_010670194.1| PREDICTED: ascorbate transporter, chloroplastic [Beta vulgaris subsp. vulgaris] gb|KMT20455.1| hypothetical protein BVRB_1g004490 [Beta vulgaris subsp. vulgaris] Length = 617 Score = 68.6 bits (166), Expect = 1e-10 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSR-----VLVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P + LLSR + V C+ QGSDAFSQSGLYSNHQDIGPRY+GVLLGLS Sbjct: 511 PALSLSLLSRARTPALAVLCMACSQGSDAFSQSGLYSNHQDIGPRYSGVLLGLS 564 >ref|XP_003594358.2| anion transporter 4 [Medicago truncatula] gb|AES64609.2| anion transporter 4 [Medicago truncatula] Length = 262 Score = 67.4 bits (163), Expect = 1e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +2 Query: 314 VRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 182 VLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 218 >gb|ONM41477.1| Ascorbate transporter chloroplastic [Zea mays] Length = 394 Score = 68.2 bits (165), Expect = 1e-10 Identities = 37/54 (68%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P + LLS+V V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 288 PALFLTLLSKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 341 >gb|EMS64245.1| putative anion transporter 4, chloroplastic [Triticum urartu] Length = 513 Score = 68.2 bits (165), Expect = 1e-10 Identities = 37/54 (68%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P + LLS+V V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 407 PALFLTLLSKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 460 >gb|OEL29965.1| Ascorbate transporter, chloroplastic [Dichanthelium oligosanthes] Length = 562 Score = 68.2 bits (165), Expect = 1e-10 Identities = 37/54 (68%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P + LLS+V V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 456 PALFLTLLSKVQTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 509 >ref|XP_015611821.1| PREDICTED: probable anion transporter 4, chloroplastic [Oryza sativa Japonica Group] sp|Q652N5.1|PHT44_ORYSJ RecName: Full=Probable anion transporter 4, chloroplastic; AltName: Full=Phosphate transporter 4;4; Flags: Precursor dbj|BAD46232.1| putative sialin [Oryza sativa Japonica Group] dbj|BAF25900.1| Os09g0570400 [Oryza sativa Japonica Group] dbj|BAG89449.1| unnamed protein product [Oryza sativa Japonica Group] gb|EEC85095.1| hypothetical protein OsI_32467 [Oryza sativa Indica Group] gb|EEE70272.1| hypothetical protein OsJ_30419 [Oryza sativa Japonica Group] dbj|BAT09513.1| Os09g0570400 [Oryza sativa Japonica Group] Length = 591 Score = 68.2 bits (165), Expect = 2e-10 Identities = 37/54 (68%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P + LLS+V V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 485 PALFLTLLSKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 538 >gb|PAN11022.1| hypothetical protein PAHAL_B01943 [Panicum hallii] Length = 596 Score = 68.2 bits (165), Expect = 2e-10 Identities = 37/54 (68%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P + LLS+V V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 490 PALFLTLLSKVQTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 543 >ref|XP_004956239.1| probable anion transporter 4, chloroplastic [Setaria italica] gb|KQL23640.1| hypothetical protein SETIT_029266mg [Setaria italica] Length = 597 Score = 68.2 bits (165), Expect = 2e-10 Identities = 37/54 (68%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P + LLS+V V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 491 PALFLTLLSKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 544 >ref|XP_002457997.2| probable anion transporter 4, chloroplastic [Sorghum bicolor] gb|KXG32707.1| hypothetical protein SORBI_3003G186800 [Sorghum bicolor] Length = 604 Score = 68.2 bits (165), Expect = 2e-10 Identities = 37/54 (68%), Positives = 40/54 (74%), Gaps = 5/54 (9%) Frame = +2 Query: 278 PFMPYQLLSRV-----LVRCLFSFQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 424 P + LLS+V V C+ QGSDAFSQSGLYSNHQDIGPRYAGVLLGLS Sbjct: 498 PALFLTLLSKVRTPAMAVLCMACSQGSDAFSQSGLYSNHQDIGPRYAGVLLGLS 551