BLASTX nr result
ID: Cheilocostus21_contig00032724
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00032724 (1472 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009416661.1| PREDICTED: ethylene-responsive transcription... 63 1e-08 ref|XP_009388064.1| PREDICTED: ethylene-responsive transcription... 57 1e-06 ref|XP_009387180.1| PREDICTED: ethylene-responsive transcription... 46 4e-06 ref|XP_020102436.1| ethylene-responsive transcription factor 8-l... 49 8e-06 gb|OAY66743.1| Ethylene-responsive transcription factor 4 [Anana... 49 8e-06 >ref|XP_009416661.1| PREDICTED: ethylene-responsive transcription factor ESR2-like [Musa acuminata subsp. malaccensis] Length = 362 Score = 63.2 bits (152), Expect(2) = 1e-08 Identities = 34/60 (56%), Positives = 37/60 (61%), Gaps = 11/60 (18%) Frame = +3 Query: 1281 MDDGNGGLHQHRXXXXXXXX-----KRTSAA------KDGTRYRGVRNRPWGRFAAEIRD 1427 M+DGNGG H HR KR +AA KDGTRYRGVR RPWGR+AAEIRD Sbjct: 1 MEDGNGGHHHHRKCSAAGSSSNNGGKRAAAAATAAPGKDGTRYRGVRRRPWGRYAAEIRD 60 Score = 26.6 bits (57), Expect(2) = 1e-08 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 1427 PSQKCRVWLGTFDTA 1471 P K R WLGTFDTA Sbjct: 61 PQSKERRWLGTFDTA 75 >ref|XP_009388064.1| PREDICTED: ethylene-responsive transcription factor ESR2-like [Musa acuminata subsp. malaccensis] Length = 341 Score = 56.6 bits (135), Expect(2) = 1e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 1341 KRTSAAKDGTRYRGVRNRPWGRFAAEIRD 1427 KR +A+KDGTRYRGVR RPWGR+AAEIRD Sbjct: 29 KRATASKDGTRYRGVRRRPWGRYAAEIRD 57 Score = 26.6 bits (57), Expect(2) = 1e-06 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +2 Query: 1427 PSQKCRVWLGTFDTA 1471 P K R WLGTFDTA Sbjct: 58 PQSKERRWLGTFDTA 72 >ref|XP_009387180.1| PREDICTED: ethylene-responsive transcription factor 11-like [Musa acuminata subsp. malaccensis] Length = 231 Score = 46.2 bits (108), Expect(2) = 4e-06 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +3 Query: 1365 GTRYRGVRNRPWGRFAAEIRD 1427 GTRYRGVR RPWGR+AAEIRD Sbjct: 26 GTRYRGVRKRPWGRYAAEIRD 46 Score = 35.0 bits (79), Expect(2) = 4e-06 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = +2 Query: 1427 PSQKCRVWLGTFDTA 1471 P++KCRVWLGTFDTA Sbjct: 47 PAKKCRVWLGTFDTA 61 >ref|XP_020102436.1| ethylene-responsive transcription factor 8-like [Ananas comosus] Length = 220 Score = 48.9 bits (115), Expect(2) = 8e-06 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +3 Query: 1350 SAAKDGTRYRGVRNRPWGRFAAEIRD 1427 +AA+ G RYRGVR RPWGRFAAEIRD Sbjct: 22 AAAEGGVRYRGVRKRPWGRFAAEIRD 47 Score = 31.2 bits (69), Expect(2) = 8e-06 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +2 Query: 1427 PSQKCRVWLGTFDTA 1471 P++K RVWLGTFDTA Sbjct: 48 PAKKSRVWLGTFDTA 62 >gb|OAY66743.1| Ethylene-responsive transcription factor 4 [Ananas comosus] Length = 217 Score = 48.9 bits (115), Expect(2) = 8e-06 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +3 Query: 1350 SAAKDGTRYRGVRNRPWGRFAAEIRD 1427 +AA+ G RYRGVR RPWGRFAAEIRD Sbjct: 22 AAAEGGVRYRGVRKRPWGRFAAEIRD 47 Score = 31.2 bits (69), Expect(2) = 8e-06 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +2 Query: 1427 PSQKCRVWLGTFDTA 1471 P++K RVWLGTFDTA Sbjct: 48 PAKKSRVWLGTFDTA 62