BLASTX nr result
ID: Cheilocostus21_contig00032525
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00032525 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009380770.1| PREDICTED: vacuolar protein sorting-associat... 102 6e-24 ref|XP_018674532.1| PREDICTED: vacuolar protein sorting-associat... 102 1e-23 ref|XP_010914069.1| PREDICTED: vacuolar protein sorting-associat... 92 6e-20 gb|PKA64410.1| Vacuolar protein sorting-associated protein 22 li... 91 3e-19 ref|XP_020679987.1| vacuolar protein sorting-associated protein ... 90 5e-19 ref|XP_020270365.1| vacuolar protein sorting-associated protein ... 90 6e-19 ref|XP_008779739.1| PREDICTED: vacuolar protein sorting-associat... 90 6e-19 ref|XP_010545217.1| PREDICTED: vacuolar protein sorting-associat... 88 2e-18 ref|XP_024012167.1| vacuolar protein sorting-associated protein ... 87 3e-18 gb|PIA58862.1| hypothetical protein AQUCO_00400010v1 [Aquilegia ... 85 5e-18 ref|XP_012070790.1| vacuolar protein sorting-associated protein ... 87 6e-18 gb|PON51531.1| ESCRT-2 complex, Snf [Parasponia andersonii] 87 8e-18 ref|XP_006401518.1| vacuolar protein sorting-associated protein ... 87 8e-18 ref|XP_011097896.1| vacuolar protein sorting-associated protein ... 87 8e-18 ref|XP_004500048.1| PREDICTED: vacuolar protein sorting-associat... 87 8e-18 gb|PIA58863.1| hypothetical protein AQUCO_00400010v1 [Aquilegia ... 85 8e-18 ref|XP_006858329.1| vacuolar protein sorting-associated protein ... 87 9e-18 gb|EXB50280.1| hypothetical protein L484_017817 [Morus notabilis] 85 1e-17 ref|XP_021836479.1| vacuolar protein sorting-associated protein ... 86 1e-17 gb|PNX95146.1| vacuolar sorting-associated protein 22-like, part... 84 2e-17 >ref|XP_009380770.1| PREDICTED: vacuolar protein sorting-associated protein 22 homolog 1 isoform X2 [Musa acuminata subsp. malaccensis] Length = 254 Score = 102 bits (255), Expect = 6e-24 Identities = 48/53 (90%), Positives = 49/53 (92%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDALRS 287 LSWS GRAIDALETLLKEGLAMIDDGH DGKRRYWFPCVASIF+APGSD RS Sbjct: 201 LSWSSGRAIDALETLLKEGLAMIDDGHRDGKRRYWFPCVASIFSAPGSDGFRS 253 >ref|XP_018674532.1| PREDICTED: vacuolar protein sorting-associated protein 22 homolog 1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 303 Score = 102 bits (255), Expect = 1e-23 Identities = 48/53 (90%), Positives = 49/53 (92%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDALRS 287 LSWS GRAIDALETLLKEGLAMIDDGH DGKRRYWFPCVASIF+APGSD RS Sbjct: 250 LSWSSGRAIDALETLLKEGLAMIDDGHRDGKRRYWFPCVASIFSAPGSDGFRS 302 >ref|XP_010914069.1| PREDICTED: vacuolar protein sorting-associated protein 22 homolog 1 [Elaeis guineensis] ref|XP_019703916.1| PREDICTED: vacuolar protein sorting-associated protein 22 homolog 1 [Elaeis guineensis] ref|XP_019703917.1| PREDICTED: vacuolar protein sorting-associated protein 22 homolog 1 [Elaeis guineensis] Length = 255 Score = 92.4 bits (228), Expect = 6e-20 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDALRST 284 LSW GRAIDALETLL+EGLAMIDDGH DGKRRYWFPCVA I AA G+D LRS+ Sbjct: 201 LSWPSGRAIDALETLLEEGLAMIDDGHRDGKRRYWFPCVAPISAALGADGLRSS 254 >gb|PKA64410.1| Vacuolar protein sorting-associated protein 22 like 1 [Apostasia shenzhenica] Length = 248 Score = 90.5 bits (223), Expect = 3e-19 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGS 302 LSWS GRA+DALETLLKEGLAMIDDGH DGKRRYWFPCVASIF++ G+ Sbjct: 201 LSWSSGRAMDALETLLKEGLAMIDDGHKDGKRRYWFPCVASIFSSGGA 248 >ref|XP_020679987.1| vacuolar protein sorting-associated protein 22 homolog 1 [Dendrobium catenatum] ref|XP_020679988.1| vacuolar protein sorting-associated protein 22 homolog 1 [Dendrobium catenatum] ref|XP_020679989.1| vacuolar protein sorting-associated protein 22 homolog 1 [Dendrobium catenatum] ref|XP_020679990.1| vacuolar protein sorting-associated protein 22 homolog 1 [Dendrobium catenatum] gb|PKU66622.1| Vacuolar protein sorting-associated protein 22 like 1 [Dendrobium catenatum] Length = 248 Score = 89.7 bits (221), Expect = 5e-19 Identities = 41/48 (85%), Positives = 43/48 (89%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGS 302 LSWS GRA+DALETLLKEGLAMIDDGH DGKRRYWFPCVASIF G+ Sbjct: 201 LSWSSGRAMDALETLLKEGLAMIDDGHRDGKRRYWFPCVASIFVTAGA 248 >ref|XP_020270365.1| vacuolar protein sorting-associated protein 22 homolog 1 [Asparagus officinalis] gb|ONK81937.1| uncharacterized protein A4U43_C01F34450 [Asparagus officinalis] Length = 253 Score = 89.7 bits (221), Expect = 6e-19 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = -3 Query: 442 SWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDALR 290 SWS GRAIDALETLL+EGLAMIDDGH DGKRRYWFPCV+SI +A GS+ L+ Sbjct: 202 SWSSGRAIDALETLLEEGLAMIDDGHRDGKRRYWFPCVSSISSATGSEGLK 252 >ref|XP_008779739.1| PREDICTED: vacuolar protein sorting-associated protein 22 homolog 1 [Phoenix dactylifera] ref|XP_008779749.1| PREDICTED: vacuolar protein sorting-associated protein 22 homolog 1 [Phoenix dactylifera] ref|XP_008779754.1| PREDICTED: vacuolar protein sorting-associated protein 22 homolog 1 [Phoenix dactylifera] ref|XP_017696711.1| PREDICTED: vacuolar protein sorting-associated protein 22 homolog 1 [Phoenix dactylifera] Length = 255 Score = 89.7 bits (221), Expect = 6e-19 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -3 Query: 442 SWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDALRST 284 SW GRAIDALETLL+EGLAMIDDGH DG+RRYWFPCVA I AA G+D LRS+ Sbjct: 202 SWPSGRAIDALETLLEEGLAMIDDGHRDGRRRYWFPCVAPISAALGADGLRSS 254 >ref|XP_010545217.1| PREDICTED: vacuolar protein sorting-associated protein 22 homolog 1 [Tarenaya hassleriana] Length = 250 Score = 88.2 bits (217), Expect = 2e-18 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDA 296 LSW GR IDALETLL+EGLAMIDDGH DGKRRYWFPCV+S++A+ G+D+ Sbjct: 201 LSWKSGRVIDALETLLEEGLAMIDDGHRDGKRRYWFPCVSSVYASAGADS 250 >ref|XP_024012167.1| vacuolar protein sorting-associated protein 22 homolog 1 isoform X2 [Eutrema salsugineum] Length = 203 Score = 86.7 bits (213), Expect = 3e-18 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -3 Query: 442 SWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSD 299 SW+ GR IDALETLL+EGLAMIDDGH DGKRRYWFPCV+S++A G+D Sbjct: 155 SWTSGRVIDALETLLEEGLAMIDDGHKDGKRRYWFPCVSSVYATSGAD 202 >gb|PIA58862.1| hypothetical protein AQUCO_00400010v1 [Aquilegia coerulea] Length = 157 Score = 85.1 bits (209), Expect = 5e-18 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDALRS 287 LSWS GRAIDAL+TLL+EGLAMIDDGH DGKRRYWFPCV S A+ GS+AL++ Sbjct: 106 LSWSSGRAIDALDTLLEEGLAMIDDGHRDGKRRYWFPCV-SFSASVGSEALKT 157 >ref|XP_012070790.1| vacuolar protein sorting-associated protein 22 homolog 1 [Jatropha curcas] gb|KDP39103.1| hypothetical protein JCGZ_00860 [Jatropha curcas] Length = 250 Score = 87.0 bits (214), Expect = 6e-18 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSD 299 LSW+ GRAIDAL+TLL EGLAMIDDGH DGKRRYWFPCVASI +A G+D Sbjct: 201 LSWTSGRAIDALDTLLDEGLAMIDDGHKDGKRRYWFPCVASISSAIGAD 249 >gb|PON51531.1| ESCRT-2 complex, Snf [Parasponia andersonii] Length = 250 Score = 86.7 bits (213), Expect = 8e-18 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSD 299 LSW+PGRAIDAL+TLL EGLAMIDDGH DGKRRYWFPCV+ I A G+D Sbjct: 201 LSWTPGRAIDALDTLLDEGLAMIDDGHKDGKRRYWFPCVSPIAALVGAD 249 >ref|XP_006401518.1| vacuolar protein sorting-associated protein 22 homolog 1 isoform X1 [Eutrema salsugineum] gb|ESQ42971.1| hypothetical protein EUTSA_v10014489mg [Eutrema salsugineum] Length = 250 Score = 86.7 bits (213), Expect = 8e-18 Identities = 37/48 (77%), Positives = 43/48 (89%) Frame = -3 Query: 442 SWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSD 299 SW+ GR IDALETLL+EGLAMIDDGH DGKRRYWFPCV+S++A G+D Sbjct: 202 SWTSGRVIDALETLLEEGLAMIDDGHKDGKRRYWFPCVSSVYATSGAD 249 >ref|XP_011097896.1| vacuolar protein sorting-associated protein 22 homolog 1 [Sesamum indicum] Length = 251 Score = 86.7 bits (213), Expect = 8e-18 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDA 296 LSWS GRA DALETLL+EGLAMIDDGH DGKRRYWFPCV+S+ + G+DA Sbjct: 201 LSWSSGRATDALETLLEEGLAMIDDGHKDGKRRYWFPCVSSVSSYTGTDA 250 >ref|XP_004500048.1| PREDICTED: vacuolar protein sorting-associated protein 22 homolog 1 [Cicer arietinum] Length = 251 Score = 86.7 bits (213), Expect = 8e-18 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDAL 293 LSW+PGRAIDAL+TLL EGLAMIDDGH DGKRRYWFPCV+ I + G D+L Sbjct: 201 LSWTPGRAIDALDTLLDEGLAMIDDGHKDGKRRYWFPCVSPISSLTGIDSL 251 >gb|PIA58863.1| hypothetical protein AQUCO_00400010v1 [Aquilegia coerulea] Length = 183 Score = 85.1 bits (209), Expect = 8e-18 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDALRS 287 LSWS GRAIDAL+TLL+EGLAMIDDGH DGKRRYWFPCV S A+ GS+AL++ Sbjct: 132 LSWSSGRAIDALDTLLEEGLAMIDDGHRDGKRRYWFPCV-SFSASVGSEALKT 183 >ref|XP_006858329.1| vacuolar protein sorting-associated protein 22 homolog 1 [Amborella trichopoda] ref|XP_020531636.1| vacuolar protein sorting-associated protein 22 homolog 1 [Amborella trichopoda] ref|XP_020531637.1| vacuolar protein sorting-associated protein 22 homolog 1 [Amborella trichopoda] gb|ERN19796.1| hypothetical protein AMTR_s00064p00139820 [Amborella trichopoda] Length = 253 Score = 86.7 bits (213), Expect = 9e-18 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDALRS 287 L WSPGRA DALE LLKEGLAMIDDGH DGK RYWFPCVASI AA +D +++ Sbjct: 201 LGWSPGRATDALEVLLKEGLAMIDDGHRDGKHRYWFPCVASISAAIEADMIKA 253 >gb|EXB50280.1| hypothetical protein L484_017817 [Morus notabilis] Length = 179 Score = 84.7 bits (208), Expect = 1e-17 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSD 299 LSW+PGRAID L+TLL EGLAMIDDGH DGKRRYWFPCV++I + G+D Sbjct: 130 LSWTPGRAIDTLDTLLDEGLAMIDDGHRDGKRRYWFPCVSTIASTVGAD 178 >ref|XP_021836479.1| vacuolar protein sorting-associated protein 22 homolog 1 [Spinacia oleracea] gb|KNA13607.1| hypothetical protein SOVF_115180 [Spinacia oleracea] Length = 253 Score = 86.3 bits (212), Expect = 1e-17 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDAL 293 LSWS GRAIDAL+TLL+EGLAMIDDGH DGKRRYWF CV+SI A G+DA+ Sbjct: 201 LSWSAGRAIDALDTLLEEGLAMIDDGHKDGKRRYWFLCVSSISAVVGADAI 251 >gb|PNX95146.1| vacuolar sorting-associated protein 22-like, partial [Trifolium pratense] Length = 151 Score = 83.6 bits (205), Expect = 2e-17 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -3 Query: 445 LSWSPGRAIDALETLLKEGLAMIDDGHVDGKRRYWFPCVASIFAAPGSDAL 293 LSW+ GRAIDAL+TLL EGLAMIDDGH DGKRRYWFPCV+ I + G D+L Sbjct: 101 LSWTSGRAIDALDTLLDEGLAMIDDGHKDGKRRYWFPCVSPISSLTGIDSL 151