BLASTX nr result
ID: Cheilocostus21_contig00032317
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00032317 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACO37267.1| RNA polymerase C, partial (chloroplast) [Vanilla ... 56 6e-07 >gb|ACO37267.1| RNA polymerase C, partial (chloroplast) [Vanilla albida] Length = 153 Score = 56.2 bits (134), Expect = 6e-07 Identities = 25/44 (56%), Positives = 29/44 (65%) Frame = +3 Query: 6 PSICNSWSNQIICCF*HRNC*N*NSEKQNPLYGKYFKKLCRGII 137 P+ICNSW NQ C F H +C NS K+ GKYF KLCRGI+ Sbjct: 35 PNICNSWFNQTTCRFQHSDCSKQNSGKRTHCMGKYFAKLCRGIL 78