BLASTX nr result
ID: Cheilocostus21_contig00032285
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00032285 (414 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009388773.1| PREDICTED: lipoyl synthase, mitochondrial-li... 71 1e-11 ref|XP_009398165.1| PREDICTED: lipoyl synthase, mitochondrial-li... 69 6e-11 gb|AFK36952.1| unknown [Lotus japonicus] 65 1e-10 gb|OMO98779.1| Lipoyl synthase [Corchorus olitorius] 67 3e-10 gb|OMO88996.1| Lipoyl synthase [Corchorus capsularis] 67 3e-10 ref|XP_012088337.1| lipoyl synthase, mitochondrial [Jatropha cur... 67 4e-10 ref|XP_007215533.1| lipoyl synthase, mitochondrial [Prunus persi... 67 4e-10 ref|XP_008230240.2| PREDICTED: LOW QUALITY PROTEIN: lipoyl synth... 66 6e-10 gb|OWM78629.1| hypothetical protein CDL15_Pgr002800 [Punica gran... 66 6e-10 ref|XP_004245423.1| PREDICTED: lipoyl synthase 1, mitochondrial-... 66 6e-10 gb|PIA40789.1| hypothetical protein AQUCO_02400096v1 [Aquilegia ... 62 7e-10 ref|XP_007043522.2| PREDICTED: lipoyl synthase, mitochondrial [T... 66 8e-10 gb|EOX99353.1| Lipoyl synthase, mitochondrial isoform 1 [Theobro... 66 8e-10 ref|XP_016705311.1| PREDICTED: lipoyl synthase, mitochondrial [G... 66 8e-10 ref|XP_012462077.1| PREDICTED: lipoyl synthase, mitochondrial [G... 66 8e-10 ref|XP_015082669.1| PREDICTED: lipoyl synthase 1, mitochondrial ... 66 8e-10 ref|XP_006357526.1| PREDICTED: lipoyl synthase 1, mitochondrial ... 66 8e-10 ref|XP_022930787.1| lipoyl synthase 2, mitochondrial-like [Cucur... 66 8e-10 ref|XP_016485743.1| PREDICTED: lipoyl synthase, mitochondrial-li... 66 8e-10 ref|XP_009621653.1| PREDICTED: lipoyl synthase, mitochondrial [N... 66 8e-10 >ref|XP_009388773.1| PREDICTED: lipoyl synthase, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 385 Score = 70.9 bits (172), Expect = 1e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASSISSD 114 FRYVASGPMVRSSYKAGEFYIKSMIE+DRA+ASS S+D Sbjct: 346 FRYVASGPMVRSSYKAGEFYIKSMIEADRAMASSTSND 383 >ref|XP_009398165.1| PREDICTED: lipoyl synthase, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 382 Score = 68.9 bits (167), Expect = 6e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASSISSD 114 FRYVASGPMVRSSYKAGEFYIKSMIE+DRA ASS SD Sbjct: 343 FRYVASGPMVRSSYKAGEFYIKSMIEADRATASSTPSD 380 >gb|AFK36952.1| unknown [Lotus japonicus] Length = 116 Score = 64.7 bits (156), Expect = 1e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMI+SDRA +SS Sbjct: 78 FRYVASGPMVRSSYKAGEFYIKSMIDSDRAASSS 111 >gb|OMO98779.1| Lipoyl synthase [Corchorus olitorius] Length = 377 Score = 67.0 bits (162), Expect = 3e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDRA ASS Sbjct: 344 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAASS 377 >gb|OMO88996.1| Lipoyl synthase [Corchorus capsularis] Length = 377 Score = 67.0 bits (162), Expect = 3e-10 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDRA ASS Sbjct: 344 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAASS 377 >ref|XP_012088337.1| lipoyl synthase, mitochondrial [Jatropha curcas] gb|KDP24175.1| hypothetical protein JCGZ_25832 [Jatropha curcas] Length = 377 Score = 66.6 bits (161), Expect = 4e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASSIS 108 FRYVASGPMVRSSYKAGEFYIKSMIESDRA +S +S Sbjct: 340 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSQLS 375 >ref|XP_007215533.1| lipoyl synthase, mitochondrial [Prunus persica] gb|ONI18713.1| hypothetical protein PRUPE_3G233600 [Prunus persica] Length = 380 Score = 66.6 bits (161), Expect = 4e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASSISS 111 FRYVASGPMVRSSYKAGEFYIKSMIESDRA +S +S+ Sbjct: 343 FRYVASGPMVRSSYKAGEFYIKSMIESDRATSSHLSA 379 >ref|XP_008230240.2| PREDICTED: LOW QUALITY PROTEIN: lipoyl synthase, mitochondrial [Prunus mume] Length = 373 Score = 66.2 bits (160), Expect = 6e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASSIS 108 FRYVASGPMVRSSYKAGEFYIKSMIESDRA +S +S Sbjct: 336 FRYVASGPMVRSSYKAGEFYIKSMIESDRATSSHLS 371 >gb|OWM78629.1| hypothetical protein CDL15_Pgr002800 [Punica granatum] gb|PKI32056.1| hypothetical protein CRG98_047528 [Punica granatum] Length = 386 Score = 66.2 bits (160), Expect = 6e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSM+ESDRA ASS Sbjct: 347 FRYVASGPMVRSSYKAGEFYIKSMLESDRAAASS 380 >ref|XP_004245423.1| PREDICTED: lipoyl synthase 1, mitochondrial-like [Solanum lycopersicum] Length = 313 Score = 65.9 bits (159), Expect = 6e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDRA +SS Sbjct: 280 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSS 313 >gb|PIA40789.1| hypothetical protein AQUCO_02400096v1 [Aquilegia coerulea] Length = 98 Score = 62.0 bits (149), Expect = 7e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALAS 99 FRY+ASGPMVRSSYKAGEFYIKSMIE DRA +S Sbjct: 62 FRYIASGPMVRSSYKAGEFYIKSMIERDRATSS 94 >ref|XP_007043522.2| PREDICTED: lipoyl synthase, mitochondrial [Theobroma cacao] Length = 376 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDRA A+S Sbjct: 343 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAAAS 376 >gb|EOX99353.1| Lipoyl synthase, mitochondrial isoform 1 [Theobroma cacao] Length = 376 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDRA A+S Sbjct: 343 FRYVASGPMVRSSYKAGEFYIKSMIESDRAAAAS 376 >ref|XP_016705311.1| PREDICTED: lipoyl synthase, mitochondrial [Gossypium hirsutum] Length = 377 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDR+ ASS Sbjct: 344 FRYVASGPMVRSSYKAGEFYIKSMIESDRSAASS 377 >ref|XP_012462077.1| PREDICTED: lipoyl synthase, mitochondrial [Gossypium raimondii] gb|KJB79957.1| hypothetical protein B456_013G074500 [Gossypium raimondii] Length = 377 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDR+ ASS Sbjct: 344 FRYVASGPMVRSSYKAGEFYIKSMIESDRSAASS 377 >ref|XP_015082669.1| PREDICTED: lipoyl synthase 1, mitochondrial [Solanum pennellii] Length = 380 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDRA +SS Sbjct: 347 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSS 380 >ref|XP_006357526.1| PREDICTED: lipoyl synthase 1, mitochondrial [Solanum tuberosum] Length = 380 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDRA +SS Sbjct: 347 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSS 380 >ref|XP_022930787.1| lipoyl synthase 2, mitochondrial-like [Cucurbita moschata] Length = 381 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDRA +SS Sbjct: 343 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSS 376 >ref|XP_016485743.1| PREDICTED: lipoyl synthase, mitochondrial-like [Nicotiana tabacum] Length = 383 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDRA +SS Sbjct: 350 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSS 383 >ref|XP_009621653.1| PREDICTED: lipoyl synthase, mitochondrial [Nicotiana tomentosiformis] Length = 383 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 FRYVASGPMVRSSYKAGEFYIKSMIESDRALASS 102 FRYVASGPMVRSSYKAGEFYIKSMIESDRA +SS Sbjct: 350 FRYVASGPMVRSSYKAGEFYIKSMIESDRAASSS 383