BLASTX nr result
ID: Cheilocostus21_contig00032213
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00032213 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015384248.1| PREDICTED: mitochondrial import receptor sub... 69 7e-13 ref|XP_002269243.1| PREDICTED: mitochondrial import receptor sub... 68 2e-12 ref|XP_012463735.1| PREDICTED: mitochondrial import receptor sub... 68 3e-12 ref|XP_016675737.1| PREDICTED: mitochondrial import receptor sub... 68 3e-12 ref|XP_021637683.1| mitochondrial import receptor subunit TOM7-1... 68 3e-12 ref|XP_021629833.1| mitochondrial import receptor subunit TOM7-1... 68 3e-12 ref|XP_021632247.1| mitochondrial import receptor subunit TOM7-1... 68 3e-12 ref|XP_009416416.1| PREDICTED: mitochondrial import receptor sub... 67 4e-12 ref|XP_022719838.1| mitochondrial import receptor subunit TOM7-1... 67 4e-12 gb|OMO88291.1| Mitochondrial import receptor [Corchorus capsularis] 67 4e-12 gb|OMO80594.1| Mitochondrial import receptor subunit TOM7 [Corch... 67 4e-12 ref|XP_009389359.1| PREDICTED: mitochondrial import receptor sub... 67 4e-12 ref|XP_009344055.1| PREDICTED: mitochondrial import receptor sub... 67 4e-12 ref|XP_008341149.1| PREDICTED: mitochondrial import receptor sub... 67 4e-12 ref|XP_006434604.1| mitochondrial import receptor subunit TOM7-1... 67 5e-12 ref|XP_021655397.1| mitochondrial import receptor subunit TOM7-1... 67 6e-12 ref|XP_019705947.1| PREDICTED: mitochondrial import receptor sub... 67 7e-12 gb|OIV93611.1| hypothetical protein TanjilG_04843 [Lupinus angus... 67 8e-12 ref|XP_008810028.1| PREDICTED: mitochondrial import receptor sub... 67 8e-12 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 67 8e-12 >ref|XP_015384248.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Citrus sinensis] gb|KDO83900.1| hypothetical protein CISIN_1g035165mg [Citrus sinensis] gb|KDO83901.1| hypothetical protein CISIN_1g035165mg [Citrus sinensis] Length = 71 Score = 69.3 bits (168), Expect = 7e-13 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKVIT YGFIPLVIIIGMNS+ KP LHQLLSPV Sbjct: 34 WAMKKAKVITHYGFIPLVIIIGMNSDPKPQLHQLLSPV 71 >ref|XP_002269243.1| PREDICTED: mitochondrial import receptor subunit TOM7-2 [Vitis vinifera] Length = 73 Score = 68.2 bits (165), Expect = 2e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WAL+KAKVIT YGFIP+VIIIGMNSE KP L+QLLSPV Sbjct: 36 WALKKAKVITHYGFIPMVIIIGMNSEPKPQLYQLLSPV 73 >ref|XP_012463735.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] ref|XP_012463736.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] gb|KJB81174.1| hypothetical protein B456_013G132400 [Gossypium raimondii] gb|KJB81175.1| hypothetical protein B456_013G132400 [Gossypium raimondii] gb|PPD94483.1| hypothetical protein GOBAR_DD08498 [Gossypium barbadense] Length = 72 Score = 67.8 bits (164), Expect = 3e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKV+T YGFIPLVIIIGMNSE KP L+QLLSPV Sbjct: 35 WAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72 >ref|XP_016675737.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Gossypium hirsutum] ref|XP_016703287.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Gossypium hirsutum] ref|XP_017608704.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium arboreum] gb|KHG28073.1| Mitochondrial import receptor subunit TOM7-1 -like protein [Gossypium arboreum] gb|PPR94623.1| hypothetical protein GOBAR_AA26047 [Gossypium barbadense] Length = 72 Score = 67.8 bits (164), Expect = 3e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKV+T YGFIPLVIIIGMNSE KP L+QLLSPV Sbjct: 35 WAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72 >ref|XP_021637683.1| mitochondrial import receptor subunit TOM7-1-like [Hevea brasiliensis] Length = 74 Score = 67.8 bits (164), Expect = 3e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WAL+KAKVIT YGFIPLVIIIGMNSE KP L+QLL+PV Sbjct: 37 WALKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLAPV 74 >ref|XP_021629833.1| mitochondrial import receptor subunit TOM7-1-like [Manihot esculenta] gb|OAY35469.1| hypothetical protein MANES_12G104200 [Manihot esculenta] Length = 74 Score = 67.8 bits (164), Expect = 3e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WAL+KAKVIT YGFIPLVIIIGMNSE KP L+QLL+PV Sbjct: 37 WALKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLTPV 74 >ref|XP_021632247.1| mitochondrial import receptor subunit TOM7-1-like [Manihot esculenta] gb|OAY33764.1| hypothetical protein MANES_13G122700 [Manihot esculenta] Length = 74 Score = 67.8 bits (164), Expect = 3e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKV+T YGFIPLVIIIGMNSE KP L+QLLSPV Sbjct: 37 WAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 74 >ref|XP_009416416.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] Length = 71 Score = 67.4 bits (163), Expect = 4e-12 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKVIT YGFIPL++IIGMNSE KP L+QLLSPV Sbjct: 34 WAMKKAKVITHYGFIPLIVIIGMNSEPKPQLYQLLSPV 71 >ref|XP_022719838.1| mitochondrial import receptor subunit TOM7-1-like [Durio zibethinus] ref|XP_022719839.1| mitochondrial import receptor subunit TOM7-1-like [Durio zibethinus] ref|XP_022719840.1| mitochondrial import receptor subunit TOM7-1-like [Durio zibethinus] Length = 72 Score = 67.4 bits (163), Expect = 4e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WAL+KAKV+T YGFIPLVIIIGMNS+ KP L+QLLSPV Sbjct: 35 WALKKAKVVTHYGFIPLVIIIGMNSDPKPQLYQLLSPV 72 >gb|OMO88291.1| Mitochondrial import receptor [Corchorus capsularis] Length = 72 Score = 67.4 bits (163), Expect = 4e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKV+T YGFIPLVIIIGMNSE KP L+QLLSPV Sbjct: 35 WAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72 >gb|OMO80594.1| Mitochondrial import receptor subunit TOM7 [Corchorus olitorius] Length = 72 Score = 67.4 bits (163), Expect = 4e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKV+T YGFIPLVIIIGMNSE KP L+QLLSPV Sbjct: 35 WAVKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72 >ref|XP_009389359.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Musa acuminata subsp. malaccensis] Length = 73 Score = 67.4 bits (163), Expect = 4e-12 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKVIT YGFIPL+I+IGMNSE KP L+QLLSPV Sbjct: 36 WAMKKAKVITHYGFIPLIIVIGMNSEPKPQLYQLLSPV 73 >ref|XP_009344055.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Pyrus x bretschneideri] Length = 73 Score = 67.4 bits (163), Expect = 4e-12 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WAL+KAKV+T YGFIPLVIIIGMNSE KP L QLLSPV Sbjct: 36 WALKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|XP_008341149.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Malus domestica] ref|XP_018497783.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Pyrus x bretschneideri] Length = 73 Score = 67.4 bits (163), Expect = 4e-12 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WAL+KAKV+T YGFIPLVIIIGMNSE KP L QLLSPV Sbjct: 36 WALKKAKVVTHYGFIPLVIIIGMNSEPKPQLSQLLSPV 73 >ref|XP_006434604.1| mitochondrial import receptor subunit TOM7-1 [Citrus clementina] ref|XP_024040722.1| mitochondrial import receptor subunit TOM7-1 [Citrus clementina] gb|ESR47843.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] gb|ESR47844.1| hypothetical protein CICLE_v10003057mg [Citrus clementina] Length = 71 Score = 67.0 bits (162), Expect = 5e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKVIT YGFIPLVIIIGMNS+ KP L+QLLSPV Sbjct: 34 WAMKKAKVITHYGFIPLVIIIGMNSDPKPQLYQLLSPV 71 >ref|XP_021655397.1| mitochondrial import receptor subunit TOM7-1-like [Hevea brasiliensis] Length = 74 Score = 67.0 bits (162), Expect = 6e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKVIT YGFIPLVIIIGMNSE KP L+QLL+PV Sbjct: 37 WAMKKAKVITHYGFIPLVIIIGMNSEPKPQLYQLLTPV 74 >ref|XP_019705947.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Elaeis guineensis] Length = 69 Score = 66.6 bits (161), Expect = 7e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKVIT YGFIPL+IIIGMNSE KP L QLLSPV Sbjct: 32 WAMKKAKVITHYGFIPLIIIIGMNSEPKPQLSQLLSPV 69 >gb|OIV93611.1| hypothetical protein TanjilG_04843 [Lupinus angustifolius] Length = 72 Score = 66.6 bits (161), Expect = 8e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WALRKAKVIT YGFIPLVII+GMNS+ KP + QLLSPV Sbjct: 35 WALRKAKVITHYGFIPLVIIVGMNSDPKPQISQLLSPV 72 >ref|XP_008810028.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Phoenix dactylifera] Length = 72 Score = 66.6 bits (161), Expect = 8e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA++KAKVIT YGFIPL+IIIGMNSE KP L QLLSPV Sbjct: 35 WAMKKAKVITHYGFIPLIIIIGMNSEPKPQLSQLLSPV 72 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Glycine max] gb|KHM99855.1| Mitochondrial import receptor subunit TOM7-1 [Glycine soja] gb|KRH60119.1| hypothetical protein GLYMA_05G2214001 [Glycine max] Length = 72 Score = 66.6 bits (161), Expect = 8e-12 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 440 WALRKAKVITQYGFIPLVIIIGMNSELKPSLHQLLSPV 327 WA+RKAKVIT YGFIPLVIIIGMNS+ KP L QLLSPV Sbjct: 35 WAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72