BLASTX nr result
ID: Cheilocostus21_contig00032190
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00032190 (511 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009381306.1| PREDICTED: outer envelope protein 61 [Musa a... 56 5e-06 >ref|XP_009381306.1| PREDICTED: outer envelope protein 61 [Musa acuminata subsp. malaccensis] Length = 581 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +1 Query: 4 KMSPEELENMFQVASSLKEEGSDVSRLGSKLPEM 105 KM PEEL+ MFQVASSL E G DVSRLGSK PEM Sbjct: 341 KMKPEELQKMFQVASSLNERGPDVSRLGSKFPEM 374