BLASTX nr result
ID: Cheilocostus21_contig00032063
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00032063 (417 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009404790.1| PREDICTED: nuclear pore complex protein NUP8... 60 7e-08 >ref|XP_009404790.1| PREDICTED: nuclear pore complex protein NUP88 [Musa acuminata subsp. malaccensis] Length = 861 Score = 60.5 bits (145), Expect = 7e-08 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 296 ERQPLQWVPLDKHLAFPSAQDSSSEAPRDGRRSSNLLAWD 415 +R PLQWVPLDKH F S Q SS ++PRD RRSSNLLAWD Sbjct: 68 KRSPLQWVPLDKHPFFSSTQ-SSGKSPRDSRRSSNLLAWD 106