BLASTX nr result
ID: Cheilocostus21_contig00031936
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00031936 (575 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009396376.1| PREDICTED: pentatricopeptide repeat-containi... 41 9e-09 >ref|XP_009396376.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Musa acuminata subsp. malaccensis] Length = 797 Score = 41.2 bits (95), Expect(3) = 9e-09 Identities = 22/43 (51%), Positives = 27/43 (62%) Frame = +1 Query: 289 GMAERAVETFGWTPELSSRPSTFTYGTM*QIHEVLPIELRALA 417 GMAE+AVE FG E SRP+TF Y T+ +I + L ALA Sbjct: 154 GMAEKAVEAFGRMSEFGSRPNTFAYNTLLRIFVDKDVILLALA 196 Score = 34.3 bits (77), Expect(3) = 9e-09 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +3 Query: 21 DLAVCNCILIIRHSVPCFEPRLFYLH--FMPHMVVDILADPP 140 +L + +L I H+VP FEP L +L H+V ++LAD P Sbjct: 43 ELVISERVLTILHTVPSFEPHLDFLSPILTHHVVEEVLADAP 84 Score = 31.2 bits (69), Expect(3) = 9e-09 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 3/37 (8%) Frame = +2 Query: 185 RSAGGFVATWRAFEELRLWGLSVAP---GLMLSGYAA 286 RS GGF + WRA +L G+ VAP ++S Y+A Sbjct: 116 RSPGGFDSAWRALADLGRQGVPVAPAAFAALISAYSA 152