BLASTX nr result
ID: Cheilocostus21_contig00031857
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00031857 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPS14370.1| hypothetical protein GOBAR_AA06209 [Gossypium bar... 70 3e-11 ref|XP_016687564.1| PREDICTED: random slug protein 5-like isofor... 68 8e-11 ref|XP_012444955.1| PREDICTED: random slug protein 5 isoform X3 ... 68 8e-11 ref|XP_016687561.1| PREDICTED: random slug protein 5-like isofor... 68 9e-11 ref|XP_012444952.1| PREDICTED: random slug protein 5 isoform X2 ... 68 9e-11 ref|XP_016687554.1| PREDICTED: random slug protein 5-like isofor... 66 7e-10 ref|XP_012444947.1| PREDICTED: random slug protein 5 isoform X1 ... 66 7e-10 ref|XP_022772756.1| random slug protein 5-like isoform X2 [Durio... 65 1e-09 gb|OMO84418.1| hypothetical protein COLO4_22084 [Corchorus olito... 65 1e-09 ref|XP_022772752.1| random slug protein 5-like isoform X1 [Durio... 65 1e-09 dbj|GAU15312.1| hypothetical protein TSUD_03810, partial [Trifol... 64 1e-09 ref|XP_021907835.1| phosphatidylinositol transfer protein PDR16 ... 65 2e-09 ref|XP_008790372.1| PREDICTED: random slug protein 5-like [Phoen... 65 2e-09 gb|AFK42611.1| unknown [Medicago truncatula] 63 2e-09 ref|XP_006434977.1| phosphatidylinositol transfer protein 3 [Cit... 64 2e-09 gb|PHT91211.1| hypothetical protein T459_06324 [Capsicum annuum] 64 2e-09 gb|PHT56573.1| hypothetical protein CQW23_05059 [Capsicum baccatum] 64 2e-09 ref|XP_016752245.1| PREDICTED: random slug protein 5-like isofor... 64 2e-09 ref|XP_016560614.1| PREDICTED: random slug protein 5-like [Capsi... 64 2e-09 ref|XP_017646037.1| PREDICTED: random slug protein 5-like isofor... 64 2e-09 >gb|PPS14370.1| hypothetical protein GOBAR_AA06209 [Gossypium barbadense] Length = 312 Score = 69.7 bits (169), Expect = 3e-11 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 158 VALNSYYYLFRIVFHGQIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWN 6 + LNS+ + + + QI+EL+AAIGPL GRSLKY +DACLRRYLEARNWN Sbjct: 23 IVLNSWLIVAVMRKYNQIKELQAAIGPLSGRSLKYCTDACLRRYLEARNWN 73 >ref|XP_016687564.1| PREDICTED: random slug protein 5-like isoform X3 [Gossypium hirsutum] ref|XP_016687565.1| PREDICTED: random slug protein 5-like isoform X3 [Gossypium hirsutum] Length = 279 Score = 68.2 bits (165), Expect = 8e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 116 HGQIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWN 6 + QI+ELRAAIGPL GRSLKY +DACLRRYLEARNWN Sbjct: 4 YNQIKELRAAIGPLSGRSLKYCTDACLRRYLEARNWN 40 >ref|XP_012444955.1| PREDICTED: random slug protein 5 isoform X3 [Gossypium raimondii] Length = 279 Score = 68.2 bits (165), Expect = 8e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 116 HGQIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWN 6 + QI+ELRAAIGPL GRSLKY +DACLRRYLEARNWN Sbjct: 4 YNQIKELRAAIGPLSGRSLKYCTDACLRRYLEARNWN 40 >ref|XP_016687561.1| PREDICTED: random slug protein 5-like isoform X2 [Gossypium hirsutum] ref|XP_016687562.1| PREDICTED: random slug protein 5-like isoform X2 [Gossypium hirsutum] ref|XP_016687563.1| PREDICTED: random slug protein 5-like isoform X2 [Gossypium hirsutum] Length = 294 Score = 68.2 bits (165), Expect = 9e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 116 HGQIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWN 6 + QI+ELRAAIGPL GRSLKY +DACLRRYLEARNWN Sbjct: 19 YNQIKELRAAIGPLSGRSLKYCTDACLRRYLEARNWN 55 >ref|XP_012444952.1| PREDICTED: random slug protein 5 isoform X2 [Gossypium raimondii] ref|XP_012444953.1| PREDICTED: random slug protein 5 isoform X2 [Gossypium raimondii] ref|XP_012444954.1| PREDICTED: random slug protein 5 isoform X2 [Gossypium raimondii] Length = 294 Score = 68.2 bits (165), Expect = 9e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 116 HGQIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWN 6 + QI+ELRAAIGPL GRSLKY +DACLRRYLEARNWN Sbjct: 19 YNQIKELRAAIGPLSGRSLKYCTDACLRRYLEARNWN 55 >ref|XP_016687554.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] ref|XP_016687556.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] ref|XP_016687557.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] ref|XP_016687558.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] ref|XP_016687559.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] ref|XP_016687560.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] Length = 295 Score = 65.9 bits (159), Expect = 7e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWN 6 +I+ELRAAIGPL GRSLKY +DACLRRYLEARNWN Sbjct: 22 KIKELRAAIGPLSGRSLKYCTDACLRRYLEARNWN 56 >ref|XP_012444947.1| PREDICTED: random slug protein 5 isoform X1 [Gossypium raimondii] ref|XP_012444948.1| PREDICTED: random slug protein 5 isoform X1 [Gossypium raimondii] ref|XP_012444949.1| PREDICTED: random slug protein 5 isoform X1 [Gossypium raimondii] ref|XP_012444950.1| PREDICTED: random slug protein 5 isoform X1 [Gossypium raimondii] ref|XP_012444951.1| PREDICTED: random slug protein 5 isoform X1 [Gossypium raimondii] gb|KJB58285.1| hypothetical protein B456_009G202600 [Gossypium raimondii] gb|KJB58286.1| hypothetical protein B456_009G202600 [Gossypium raimondii] gb|KJB58287.1| hypothetical protein B456_009G202600 [Gossypium raimondii] gb|KJB58288.1| hypothetical protein B456_009G202600 [Gossypium raimondii] gb|KJB58289.1| hypothetical protein B456_009G202600 [Gossypium raimondii] gb|KJB58290.1| hypothetical protein B456_009G202600 [Gossypium raimondii] Length = 295 Score = 65.9 bits (159), Expect = 7e-10 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWN 6 +I+ELRAAIGPL GRSLKY +DACLRRYLEARNWN Sbjct: 22 KIKELRAAIGPLSGRSLKYCTDACLRRYLEARNWN 56 >ref|XP_022772756.1| random slug protein 5-like isoform X2 [Durio zibethinus] ref|XP_022772757.1| random slug protein 5-like isoform X2 [Durio zibethinus] ref|XP_022772758.1| random slug protein 5-like isoform X2 [Durio zibethinus] ref|XP_022772759.1| random slug protein 5-like isoform X2 [Durio zibethinus] Length = 294 Score = 65.1 bits (157), Expect = 1e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWNL 3 +++ELRAA+GPL GRSLKY +DACLRRYLEARNWN+ Sbjct: 21 KVKELRAALGPLSGRSLKYCTDACLRRYLEARNWNV 56 >gb|OMO84418.1| hypothetical protein COLO4_22084 [Corchorus olitorius] Length = 306 Score = 65.1 bits (157), Expect = 1e-09 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWNL 3 QI ELR AIGPL GRS KY SDACLRRYLEARNWN+ Sbjct: 30 QISELRTAIGPLSGRSAKYCSDACLRRYLEARNWNV 65 >ref|XP_022772752.1| random slug protein 5-like isoform X1 [Durio zibethinus] ref|XP_022772753.1| random slug protein 5-like isoform X1 [Durio zibethinus] ref|XP_022772754.1| random slug protein 5-like isoform X1 [Durio zibethinus] ref|XP_022772755.1| random slug protein 5-like isoform X1 [Durio zibethinus] Length = 308 Score = 65.1 bits (157), Expect = 1e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWNL 3 +++ELRAA+GPL GRSLKY +DACLRRYLEARNWN+ Sbjct: 35 KVKELRAALGPLSGRSLKYCTDACLRRYLEARNWNV 70 >dbj|GAU15312.1| hypothetical protein TSUD_03810, partial [Trifolium subterraneum] Length = 240 Score = 64.3 bits (155), Expect = 1e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 119 FHGQIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWNL 3 F+ QI+EL+ AIGPL G S KY +DACLRRYLEARNWN+ Sbjct: 3 FYNQIDELKVAIGPLSGHSSKYCTDACLRRYLEARNWNV 41 >ref|XP_021907835.1| phosphatidylinositol transfer protein PDR16 [Carica papaya] Length = 294 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWNL 3 ++ ELRAA+GPL GRSLKY +DACLRRYLEARNWN+ Sbjct: 21 KVSELRAALGPLSGRSLKYCTDACLRRYLEARNWNV 56 >ref|XP_008790372.1| PREDICTED: random slug protein 5-like [Phoenix dactylifera] Length = 298 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWNL 3 +I ELRAA+GPL GRSLKY +DACLRRYLEARNWN+ Sbjct: 22 KINELRAAMGPLSGRSLKYCTDACLRRYLEARNWNV 57 >gb|AFK42611.1| unknown [Medicago truncatula] Length = 195 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWNL 3 ++ ELRAAIGPL GR LKY +DACLRRYLEARNWN+ Sbjct: 22 KVAELRAAIGPLSGRRLKYCTDACLRRYLEARNWNV 57 >ref|XP_006434977.1| phosphatidylinositol transfer protein 3 [Citrus clementina] ref|XP_006434978.1| phosphatidylinositol transfer protein 3 [Citrus clementina] ref|XP_006473487.1| PREDICTED: random slug protein 5 [Citrus sinensis] ref|XP_006473488.1| PREDICTED: random slug protein 5 [Citrus sinensis] ref|XP_006473489.1| PREDICTED: random slug protein 5 [Citrus sinensis] gb|ESR48217.1| hypothetical protein CICLE_v10002080mg [Citrus clementina] gb|ESR48218.1| hypothetical protein CICLE_v10002080mg [Citrus clementina] gb|ESR48219.1| hypothetical protein CICLE_v10002080mg [Citrus clementina] dbj|GAY43093.1| hypothetical protein CUMW_071930 [Citrus unshiu] dbj|GAY43094.1| hypothetical protein CUMW_071930 [Citrus unshiu] dbj|GAY43095.1| hypothetical protein CUMW_071930 [Citrus unshiu] dbj|GAY43096.1| hypothetical protein CUMW_071930 [Citrus unshiu] Length = 286 Score = 64.3 bits (155), Expect = 2e-09 Identities = 27/36 (75%), Positives = 35/36 (97%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWNL 3 +++EL+AAIGPL+GRSL+Y SDACL+RYLEARNWN+ Sbjct: 19 KVKELKAAIGPLYGRSLQYCSDACLKRYLEARNWNV 54 >gb|PHT91211.1| hypothetical protein T459_06324 [Capsicum annuum] Length = 295 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWNL 3 ++ ELRAA+GPL GRSLK+ +DACLRRYLEARNWNL Sbjct: 21 KVNELRAALGPLSGRSLKFCTDACLRRYLEARNWNL 56 >gb|PHT56573.1| hypothetical protein CQW23_05059 [Capsicum baccatum] Length = 295 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWNL 3 ++ ELRAA+GPL GRSLK+ +DACLRRYLEARNWNL Sbjct: 21 KVNELRAALGPLSGRSLKFCTDACLRRYLEARNWNL 56 >ref|XP_016752245.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] ref|XP_016752246.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] ref|XP_016752247.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] ref|XP_016752248.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] ref|XP_016752249.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] ref|XP_016752250.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium hirsutum] Length = 295 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWN 6 +I+EL+AAIGPL GRSLKY +DACLRRYLEARNWN Sbjct: 22 KIKELQAAIGPLSGRSLKYCTDACLRRYLEARNWN 56 >ref|XP_016560614.1| PREDICTED: random slug protein 5-like [Capsicum annuum] ref|XP_016560615.1| PREDICTED: random slug protein 5-like [Capsicum annuum] Length = 295 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWNL 3 ++ ELRAA+GPL GRSLK+ +DACLRRYLEARNWNL Sbjct: 21 KVNELRAALGPLSGRSLKFCTDACLRRYLEARNWNL 56 >ref|XP_017646037.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium arboreum] ref|XP_017646038.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium arboreum] ref|XP_017646039.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium arboreum] ref|XP_017646040.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium arboreum] ref|XP_017646041.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium arboreum] ref|XP_017646042.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium arboreum] ref|XP_017646043.1| PREDICTED: random slug protein 5-like isoform X1 [Gossypium arboreum] gb|KHG19410.1| Random slug 5 [Gossypium arboreum] Length = 295 Score = 64.3 bits (155), Expect = 2e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -3 Query: 110 QIEELRAAIGPLHGRSLKYYSDACLRRYLEARNWN 6 +I+EL+AAIGPL GRSLKY +DACLRRYLEARNWN Sbjct: 22 KIKELQAAIGPLSGRSLKYCTDACLRRYLEARNWN 56