BLASTX nr result
ID: Cheilocostus21_contig00031708
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00031708 (1203 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009420633.1| hypothetical chloroplast RF19 (chloroplast) ... 52 5e-08 ref|YP_009420619.1| hypothetical chloroplast RF19 (chloroplast) ... 52 5e-08 ref|YP_008854652.1| hypothetical chloroplast RF19 [Curcuma rosco... 52 9e-08 gb|AGE93428.1| hypothetical chloroplast RF19 (plastid) [Alpinia ... 52 9e-08 ref|YP_009429027.1| hypothetical chloroplast RF19 (chloroplast) ... 52 9e-08 ref|YP_009462858.1| Ycf1 (chloroplast) [Amomum compactum] >gi|13... 52 9e-08 ref|YP_009459099.1| Ycf1 (chloroplast) [Amomum krervanh] >gi|133... 52 9e-08 ref|YP_009459111.1| Ycf1 (chloroplast) [Amomum krervanh] >gi|133... 52 9e-08 ref|YP_009462870.1| Ycf1 (chloroplast) [Amomum compactum] >gi|13... 52 9e-08 ref|YP_009429039.1| putative hypothetical chloroplast RF19 (chlo... 52 9e-08 ref|YP_007475762.1| hypothetical chloroplast RF19 [Zingiber spec... 52 1e-07 ref|YP_009193020.1| hypothetical chloroplast RF19 (chloroplast) ... 52 1e-07 gb|AEX94009.1| hypothetical chloroplast RF19 (chloroplast) [Aspa... 45 4e-06 ref|YP_009432783.1| hypothetical protein ycf1 (chloroplast) [Mil... 47 6e-06 ref|YP_009092727.1| hypothetical protein ycf1 [Eustrephus latifo... 46 7e-06 gb|AEX94030.1| hypothetical chloroplast RF19 (chloroplast) [Ophi... 45 7e-06 >ref|YP_009420633.1| hypothetical chloroplast RF19 (chloroplast) [Musa itinerans] gb|ASO76321.1| hypothetical chloroplast RF19 (chloroplast) [Musa itinerans] Length = 1911 Score = 51.6 bits (122), Expect(2) = 5e-08 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 5/43 (11%) Frame = -2 Query: 170 ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ*KNY 57 IS+ LDI +K TRLCNDE++QEYLPKA NGPY G K + Sbjct: 494 ISLALDILEKRTRLCNDENEQEYLPKAYDPFLNGPYRGTIKKF 536 Score = 35.4 bits (80), Expect(2) = 5e-08 Identities = 16/19 (84%), Positives = 19/19 (100%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IKTLE+ Sbjct: 466 QKKYNLSNELISRIKTLEE 484 >ref|YP_009420619.1| hypothetical chloroplast RF19 (chloroplast) [Musa itinerans] gb|ASO76307.1| hypothetical chloroplast RF19 (chloroplast) [Musa itinerans] Length = 1663 Score = 51.6 bits (122), Expect(2) = 5e-08 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 5/43 (11%) Frame = -2 Query: 170 ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ*KNY 57 IS+ LDI +K TRLCNDE++QEYLPKA NGPY G K + Sbjct: 494 ISLALDILEKRTRLCNDENEQEYLPKAYDPFLNGPYRGTIKKF 536 Score = 35.4 bits (80), Expect(2) = 5e-08 Identities = 16/19 (84%), Positives = 19/19 (100%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IKTLE+ Sbjct: 466 QKKYNLSNELISRIKTLEE 484 >ref|YP_008854652.1| hypothetical chloroplast RF19 [Curcuma roscoeana] gb|AHA13154.1| hypothetical chloroplast RF19 (plastid) [Curcuma roscoeana] Length = 1815 Score = 51.6 bits (122), Expect(2) = 9e-08 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ 69 K+ +S+TLDI +K TRLCNDE+KQEYLPKA NG Y G+ Sbjct: 419 KEKVSLTLDILEKRTRLCNDENKQEYLPKAYDPLLNGAYRGK 460 Score = 34.7 bits (78), Expect(2) = 9e-08 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IK LEK Sbjct: 401 QKKYNLSNELISRIKILEK 419 >gb|AGE93428.1| hypothetical chloroplast RF19 (plastid) [Alpinia zerumbet] Length = 1795 Score = 51.6 bits (122), Expect(2) = 9e-08 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ 69 K+ +S+TLDI +K TRLCNDE+KQEYLPKA NG Y G+ Sbjct: 419 KEKVSLTLDILEKRTRLCNDENKQEYLPKAYDPLLNGAYRGK 460 Score = 34.7 bits (78), Expect(2) = 9e-08 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IK LEK Sbjct: 401 QKKYNLSNELISRIKILEK 419 >ref|YP_009429027.1| hypothetical chloroplast RF19 (chloroplast) [Alpinia oxyphylla] gb|ASW20489.1| hypothetical chloroplast RF19 (chloroplast) [Alpinia oxyphylla] Length = 1793 Score = 51.6 bits (122), Expect(2) = 9e-08 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ 69 K+ +S+TLDI +K TRLCNDE+KQEYLPKA NG Y G+ Sbjct: 419 KEKVSLTLDILEKRTRLCNDENKQEYLPKAYDPLLNGAYRGK 460 Score = 34.7 bits (78), Expect(2) = 9e-08 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IK LEK Sbjct: 401 QKKYNLSNELISRIKILEK 419 >ref|YP_009462858.1| Ycf1 (chloroplast) [Amomum compactum] gb|AUW35061.1| Ycf1 (chloroplast) [Amomum compactum] Length = 1313 Score = 51.6 bits (122), Expect(2) = 9e-08 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ 69 K+ +S+TLDI +K TRLCNDE+KQEYLPKA NG Y G+ Sbjct: 419 KEKVSLTLDILEKRTRLCNDENKQEYLPKAYDPLLNGAYRGK 460 Score = 34.7 bits (78), Expect(2) = 9e-08 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IK LEK Sbjct: 401 QKKYNLSNELISRIKILEK 419 >ref|YP_009459099.1| Ycf1 (chloroplast) [Amomum krervanh] gb|AUS84029.1| Ycf1 (chloroplast) [Amomum krervanh] Length = 1303 Score = 51.6 bits (122), Expect(2) = 9e-08 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ 69 K+ +S+TLDI +K TRLCNDE+KQEYLPKA NG Y G+ Sbjct: 419 KEKVSLTLDILEKRTRLCNDENKQEYLPKAYDPLLNGAYRGK 460 Score = 34.7 bits (78), Expect(2) = 9e-08 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IK LEK Sbjct: 401 QKKYNLSNELISRIKILEK 419 >ref|YP_009459111.1| Ycf1 (chloroplast) [Amomum krervanh] gb|AUS84030.1| Ycf1 (chloroplast) [Amomum krervanh] Length = 1244 Score = 51.6 bits (122), Expect(2) = 9e-08 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ 69 K+ +S+TLDI +K TRLCNDE+KQEYLPKA NG Y G+ Sbjct: 419 KEKVSLTLDILEKRTRLCNDENKQEYLPKAYDPLLNGAYRGK 460 Score = 34.7 bits (78), Expect(2) = 9e-08 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IK LEK Sbjct: 401 QKKYNLSNELISRIKILEK 419 >ref|YP_009462870.1| Ycf1 (chloroplast) [Amomum compactum] gb|AUW35062.1| Ycf1 (chloroplast) [Amomum compactum] Length = 1212 Score = 51.6 bits (122), Expect(2) = 9e-08 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ 69 K+ +S+TLDI +K TRLCNDE+KQEYLPKA NG Y G+ Sbjct: 183 KEKVSLTLDILEKRTRLCNDENKQEYLPKAYDPLLNGAYRGK 224 Score = 34.7 bits (78), Expect(2) = 9e-08 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IK LEK Sbjct: 165 QKKYNLSNELISRIKILEK 183 >ref|YP_009429039.1| putative hypothetical chloroplast RF19 (chloroplast) [Alpinia oxyphylla] gb|ASW20501.1| putative hypothetical chloroplast RF19 (chloroplast) [Alpinia oxyphylla] Length = 1006 Score = 51.6 bits (122), Expect(2) = 9e-08 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ 69 K+ +S+TLDI +K TRLCNDE+KQEYLPKA NG Y G+ Sbjct: 419 KEKVSLTLDILEKRTRLCNDENKQEYLPKAYDPLLNGAYRGK 460 Score = 34.7 bits (78), Expect(2) = 9e-08 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IK LEK Sbjct: 401 QKKYNLSNELISRIKILEK 419 >ref|YP_007475762.1| hypothetical chloroplast RF19 [Zingiber spectabile] gb|AGE92827.1| hypothetical chloroplast RF19 (plastid) [Zingiber spectabile] Length = 1817 Score = 51.6 bits (122), Expect(2) = 1e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ 69 K+ +S+TLDI +K TRLCNDE+KQEYLPKA NG Y G+ Sbjct: 421 KEKVSLTLDILEKRTRLCNDENKQEYLPKAYDPLLNGAYRGK 462 Score = 33.9 bits (76), Expect(2) = 1e-07 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IK +EK Sbjct: 403 QKKYNLSNELISRIKIIEK 421 >ref|YP_009193020.1| hypothetical chloroplast RF19 (chloroplast) [Curcuma flaviflora] gb|ALP83604.1| hypothetical chloroplast RF19 (chloroplast) [Curcuma flaviflora] Length = 1815 Score = 51.6 bits (122), Expect(2) = 1e-07 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPKA-----NGPYCGQ 69 K+ +S+TLDI +K TRLCNDE+KQEYLPKA NG Y G+ Sbjct: 419 KEKVSLTLDILEKRTRLCNDENKQEYLPKAYDPLLNGAYRGK 460 Score = 33.9 bits (76), Expect(2) = 1e-07 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IK +EK Sbjct: 401 QKKYNLSNELISRIKIIEK 419 >gb|AEX94009.1| hypothetical chloroplast RF19 (chloroplast) [Asparagus asparagoides] Length = 1808 Score = 44.7 bits (104), Expect(2) = 4e-06 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 5/42 (11%) Frame = -2 Query: 167 SITLDIFKKWTRLCNDESKQEYLPK-----ANGPYCGQ*KNY 57 S+ LD+ +K TRLC+DE++++YLPK NGPY G KN+ Sbjct: 420 SLALDMLEKRTRLCDDENEEKYLPKRYDPFLNGPYRGTIKNF 461 Score = 35.8 bits (81), Expect(2) = 4e-06 Identities = 16/19 (84%), Positives = 19/19 (100%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNL+NELIS+IKTLEK Sbjct: 398 QKKYNLNNELISRIKTLEK 416 >ref|YP_009432783.1| hypothetical protein ycf1 (chloroplast) [Milla biflora] gb|ATB19039.1| hypothetical protein ycf1 (chloroplast) [Milla biflora] Length = 1828 Score = 47.4 bits (111), Expect(2) = 6e-06 Identities = 23/46 (50%), Positives = 32/46 (69%), Gaps = 5/46 (10%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPK-----ANGPYCGQ*KNY 57 K+ +S+ LD+ +K TRLCNDE++QEYLP+ NGPY G K + Sbjct: 423 KEKVSLALDMLEKRTRLCNDENEQEYLPQMYDPFLNGPYRGTIKKF 468 Score = 32.7 bits (73), Expect(2) = 6e-06 Identities = 14/19 (73%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNL+NELIS+IK +EK Sbjct: 405 QKKYNLNNELISRIKIIEK 423 >ref|YP_009092727.1| hypothetical protein ycf1 [Eustrephus latifolius] ref|YP_009092739.1| hypothetical protein ycf1 [Eustrephus latifolius] gb|AIR12578.1| hypothetical protein ycf1 (plastid) [Eustrephus latifolius] gb|AIR12579.1| hypothetical protein ycf1 (plastid) [Eustrephus latifolius] Length = 1777 Score = 46.2 bits (108), Expect(2) = 7e-06 Identities = 25/45 (55%), Positives = 31/45 (68%), Gaps = 5/45 (11%) Frame = -2 Query: 179 KK*ISITLDIFKKWTRLCNDESKQEYLPK-----ANGPYCGQ*KN 60 KK S+TLDI +K TRLC D++++EYLPK NGPY G KN Sbjct: 434 KKKGSLTLDILEKKTRLCLDQNRKEYLPKRYDPLLNGPYRGTIKN 478 Score = 33.5 bits (75), Expect(2) = 7e-06 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -1 Query: 234 NKKKYNLSNELISQIKTLEK 175 ++KKYNL NELIS+IK LEK Sbjct: 415 DQKKYNLKNELISRIKILEK 434 >gb|AEX94030.1| hypothetical chloroplast RF19 (chloroplast) [Ophiopogon japonicus] Length = 1741 Score = 45.1 bits (105), Expect(2) = 7e-06 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 5/42 (11%) Frame = -2 Query: 167 SITLDIFKKWTRLCNDESKQEYLPK-----ANGPYCGQ*KNY 57 S+ LD+ +K TRLC+DE++QEYLPK NGPY G K + Sbjct: 418 SLALDMLEKRTRLCDDENEQEYLPKRYDPFLNGPYRGTIKKF 459 Score = 34.7 bits (78), Expect(2) = 7e-06 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -1 Query: 231 KKKYNLSNELISQIKTLEK 175 +KKYNLSNELIS+IK LEK Sbjct: 396 QKKYNLSNELISRIKILEK 414