BLASTX nr result
ID: Cheilocostus21_contig00031405
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00031405 (441 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMO56262.1| hypothetical protein CCACVL1_26676 [Corchorus cap... 79 3e-16 gb|KVI10270.1| BTB/POZ-like protein [Cynara cardunculus var. sco... 80 1e-14 gb|PKA49172.1| BTB/POZ domain-containing protein [Apostasia shen... 78 4e-14 ref|XP_020083330.1| BTB/POZ domain-containing protein At1g55760 ... 77 8e-14 gb|OAY76251.1| BTB/POZ domain-containing protein [Ananas comosus] 77 8e-14 gb|OAY70549.1| BTB/POZ domain-containing protein [Ananas comosus] 77 8e-14 ref|XP_020583923.1| BTB/POZ domain-containing protein At1g55760-... 75 3e-13 gb|KCW68348.1| hypothetical protein EUGRSUZ_F02008 [Eucalyptus g... 74 7e-13 ref|XP_010928036.1| PREDICTED: BTB/POZ domain-containing protein... 74 7e-13 ref|XP_010061411.1| PREDICTED: BTB/POZ domain-containing protein... 74 7e-13 ref|XP_009390597.1| PREDICTED: BTB/POZ domain-containing protein... 74 1e-12 ref|XP_020704986.1| BTB/POZ domain-containing protein At1g55760-... 72 5e-12 ref|XP_020704985.1| BTB/POZ domain-containing protein At1g55760-... 72 5e-12 ref|XP_019266387.1| PREDICTED: BTB/POZ domain-containing protein... 72 5e-12 ref|XP_009777616.1| PREDICTED: BTB/POZ domain-containing protein... 72 5e-12 ref|XP_009632024.1| PREDICTED: BTB/POZ domain-containing protein... 72 5e-12 gb|AFK49561.1| unknown [Lotus japonicus] 72 7e-12 ref|XP_020225344.1| BTB/POZ domain-containing protein At1g55760 ... 72 7e-12 ref|XP_017409304.1| PREDICTED: BTB/POZ domain-containing protein... 72 7e-12 ref|XP_014517135.1| BTB/POZ domain-containing protein At1g55760 ... 72 7e-12 >gb|OMO56262.1| hypothetical protein CCACVL1_26676 [Corchorus capsularis] Length = 105 Score = 79.0 bits (193), Expect = 3e-16 Identities = 41/71 (57%), Positives = 48/71 (67%), Gaps = 2/71 (2%) Frame = -3 Query: 211 VKLGKAGELL--GIFDCINEVTXXXXXXXXAGMSERAYRVDTTPRLAQWRIETLDSCSYC 38 V LGK+GE L G FDCI+E+T MS+ AYRV+TT RLAQWRI+ L SC+YC Sbjct: 26 VNLGKSGEYLLEGKFDCIHEITSALALSR---MSDSAYRVETTARLAQWRIDNLASCTYC 82 Query: 37 KSHPFKIGLWN 5 KS PF I WN Sbjct: 83 KSDPFNIDNWN 93 >gb|KVI10270.1| BTB/POZ-like protein [Cynara cardunculus var. scolymus] Length = 375 Score = 79.7 bits (195), Expect = 1e-14 Identities = 41/74 (55%), Positives = 51/74 (68%), Gaps = 2/74 (2%) Frame = -3 Query: 217 QQVKLGKAGELL--GIFDCINEVTXXXXXXXXAGMSERAYRVDTTPRLAQWRIETLDSCS 44 +Q LGK GELL GIFDC +E+T M++ AYRVDTT RLAQWRI+ L + + Sbjct: 29 RQDNLGKHGELLLDGIFDCFHEITTALAFAR---MNDSAYRVDTTSRLAQWRIDNLAAFT 85 Query: 43 YCKSHPFKIGLWNW 2 Y KS+PF+IG WNW Sbjct: 86 YRKSNPFRIGKWNW 99 >gb|PKA49172.1| BTB/POZ domain-containing protein [Apostasia shenzhenica] Length = 329 Score = 77.8 bits (190), Expect = 4e-14 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MSE AYRV+TTPRLAQWRIETL SC+Y KS PFKIGLWNW Sbjct: 1 MSESAYRVETTPRLAQWRIETLSSCTYRKSDPFKIGLWNW 40 >ref|XP_020083330.1| BTB/POZ domain-containing protein At1g55760 [Ananas comosus] Length = 329 Score = 77.0 bits (188), Expect = 8e-14 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRVDTTPRLAQWRI+TL SC+Y KS PFKIGLWNW Sbjct: 1 MSDSAYRVDTTPRLAQWRIDTLSSCTYRKSDPFKIGLWNW 40 >gb|OAY76251.1| BTB/POZ domain-containing protein [Ananas comosus] Length = 329 Score = 77.0 bits (188), Expect = 8e-14 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRVDTTPRLAQWRI+TL SC+Y KS PFKIGLWNW Sbjct: 1 MSDSAYRVDTTPRLAQWRIDTLSSCTYRKSDPFKIGLWNW 40 >gb|OAY70549.1| BTB/POZ domain-containing protein [Ananas comosus] Length = 329 Score = 77.0 bits (188), Expect = 8e-14 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRVDTTPRLAQWRI+TL SC+Y KS PFKIGLWNW Sbjct: 1 MSDSAYRVDTTPRLAQWRIDTLSSCTYRKSDPFKIGLWNW 40 >ref|XP_020583923.1| BTB/POZ domain-containing protein At1g55760-like [Phalaenopsis equestris] Length = 341 Score = 75.5 bits (184), Expect = 3e-13 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 124 GMSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 GMSE A+RV+TTPRLAQWRIETL S SY KS PFKIGLWNW Sbjct: 11 GMSESAFRVETTPRLAQWRIETLSSFSYRKSDPFKIGLWNW 51 >gb|KCW68348.1| hypothetical protein EUGRSUZ_F02008 [Eucalyptus grandis] Length = 326 Score = 74.3 bits (181), Expect = 7e-13 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRVDTTPRLAQWRI+ L SC+Y KS PFKIGLWNW Sbjct: 1 MSDSAYRVDTTPRLAQWRIDNLASCTYRKSDPFKIGLWNW 40 >ref|XP_010928036.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 isoform X2 [Elaeis guineensis] Length = 329 Score = 74.3 bits (181), Expect = 7e-13 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 M+E AYRV+TTPRLAQWRI+TL SC+Y KS PFK+GLWNW Sbjct: 1 MNESAYRVETTPRLAQWRIDTLSSCTYRKSDPFKMGLWNW 40 >ref|XP_010061411.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Eucalyptus grandis] gb|KCW68349.1| hypothetical protein EUGRSUZ_F02008 [Eucalyptus grandis] Length = 329 Score = 74.3 bits (181), Expect = 7e-13 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRVDTTPRLAQWRI+ L SC+Y KS PFKIGLWNW Sbjct: 1 MSDSAYRVDTTPRLAQWRIDNLASCTYRKSDPFKIGLWNW 40 >ref|XP_009390597.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Musa acuminata subsp. malaccensis] Length = 329 Score = 73.9 bits (180), Expect = 1e-12 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS RAYRV+T PRLAQWRI+TL +C+Y KS PFKIGLWNW Sbjct: 1 MSNRAYRVETAPRLAQWRIDTLSACTYRKSDPFKIGLWNW 40 >ref|XP_020704986.1| BTB/POZ domain-containing protein At1g55760-like isoform X2 [Dendrobium catenatum] Length = 325 Score = 72.0 bits (175), Expect = 5e-12 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MSE AYRVDT RLAQWRIE L SC+Y KS PFKIGLWNW Sbjct: 1 MSESAYRVDTISRLAQWRIEALSSCTYRKSDPFKIGLWNW 40 >ref|XP_020704985.1| BTB/POZ domain-containing protein At1g55760-like isoform X1 [Dendrobium catenatum] Length = 325 Score = 72.0 bits (175), Expect = 5e-12 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MSE AYRVDT RLAQWRIE L SC+Y KS PFKIGLWNW Sbjct: 1 MSESAYRVDTISRLAQWRIEALSSCTYRKSDPFKIGLWNW 40 >ref|XP_019266387.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Nicotiana attenuata] gb|OIT35091.1| btbpoz domain-containing protein [Nicotiana attenuata] Length = 328 Score = 72.0 bits (175), Expect = 5e-12 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRVDTTPRLAQWRI+ L SC+Y KS PFKIG WNW Sbjct: 1 MSDSAYRVDTTPRLAQWRIDNLASCTYRKSDPFKIGKWNW 40 >ref|XP_009777616.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Nicotiana sylvestris] ref|XP_016439361.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Nicotiana tabacum] Length = 328 Score = 72.0 bits (175), Expect = 5e-12 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRVDTTPRLAQWRI+ L SC+Y KS PFKIG WNW Sbjct: 1 MSDSAYRVDTTPRLAQWRIDNLASCTYRKSDPFKIGKWNW 40 >ref|XP_009632024.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Nicotiana tomentosiformis] ref|XP_016511009.1| PREDICTED: BTB/POZ domain-containing protein At1g55760-like [Nicotiana tabacum] Length = 328 Score = 72.0 bits (175), Expect = 5e-12 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRVDTTPRLAQWRI+ L SC+Y KS PFKIG WNW Sbjct: 1 MSDSAYRVDTTPRLAQWRIDNLASCTYRKSDPFKIGKWNW 40 >gb|AFK49561.1| unknown [Lotus japonicus] Length = 328 Score = 71.6 bits (174), Expect = 7e-12 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRV+TTPRLAQWRIE L SC+Y KS PFKIG WNW Sbjct: 1 MSDSAYRVETTPRLAQWRIENLASCTYRKSDPFKIGKWNW 40 >ref|XP_020225344.1| BTB/POZ domain-containing protein At1g55760 [Cajanus cajan] gb|KYP76257.1| TD and POZ domain-containing protein 4 [Cajanus cajan] Length = 328 Score = 71.6 bits (174), Expect = 7e-12 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRV+TTPRLAQWRIE L SC+Y KS PFKIG WNW Sbjct: 1 MSDSAYRVETTPRLAQWRIENLASCTYRKSDPFKIGKWNW 40 >ref|XP_017409304.1| PREDICTED: BTB/POZ domain-containing protein At1g55760 [Vigna angularis] dbj|BAT88446.1| hypothetical protein VIGAN_05194200 [Vigna angularis var. angularis] Length = 328 Score = 71.6 bits (174), Expect = 7e-12 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRV+TTPRLAQWRIE L SC+Y KS PFKIG WNW Sbjct: 1 MSDSAYRVETTPRLAQWRIENLASCTYRKSDPFKIGKWNW 40 >ref|XP_014517135.1| BTB/POZ domain-containing protein At1g55760 [Vigna radiata var. radiata] Length = 328 Score = 71.6 bits (174), Expect = 7e-12 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -3 Query: 121 MSERAYRVDTTPRLAQWRIETLDSCSYCKSHPFKIGLWNW 2 MS+ AYRV+TTPRLAQWRIE L SC+Y KS PFKIG WNW Sbjct: 1 MSDSAYRVETTPRLAQWRIENLASCTYRKSDPFKIGKWNW 40