BLASTX nr result
ID: Cheilocostus21_contig00031335
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00031335 (557 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAY76170.1| 2'-deoxymugineic-acid 2'-dioxygenase, partial [An... 63 8e-09 ref|XP_020115050.1| 2'-deoxymugineic-acid 2'-dioxygenase-like [A... 63 3e-08 >gb|OAY76170.1| 2'-deoxymugineic-acid 2'-dioxygenase, partial [Ananas comosus] Length = 193 Score = 62.8 bits (151), Expect = 8e-09 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 556 IAPAKSLVSGDNPPLYKSFTFKEFLSFYTAAEANRGTVMEAFKI 425 IAPAKSL++ NPP YKSFTF+EFLS Y AA ANR V+E FKI Sbjct: 148 IAPAKSLINEHNPPKYKSFTFEEFLSAYNAAAANREGVLEYFKI 191 >ref|XP_020115050.1| 2'-deoxymugineic-acid 2'-dioxygenase-like [Ananas comosus] Length = 342 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = -2 Query: 556 IAPAKSLVSGDNPPLYKSFTFKEFLSFYTAAEANRGTVMEAFKI 425 IAPAKSL++ NPP YKSFTF+EFLS Y AA ANR V+E FKI Sbjct: 297 IAPAKSLINEHNPPKYKSFTFEEFLSAYNAAAANREGVLEYFKI 340