BLASTX nr result
ID: Cheilocostus21_contig00031246
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00031246 (410 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONM40875.1| Mitochondrial outer membrane protein porin 3 [Zea... 71 9e-13 gb|ACG25664.1| outer plastidial membrane protein porin [Zea mays] 71 6e-12 ref|NP_001141587.1| outer plastidial membrane protein porin [Zea... 71 6e-12 ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane prot... 70 1e-11 ref|XP_002458065.1| outer plastidial membrane protein porin [Sor... 70 1e-11 gb|PAN29987.1| hypothetical protein PAHAL_E02604 [Panicum hallii] 70 2e-11 ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane prot... 69 2e-11 gb|OEL19305.1| Mitochondrial outer membrane protein porin 3 [Dic... 69 3e-11 ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane prot... 69 3e-11 ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane prot... 69 3e-11 ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane prot... 69 3e-11 ref|XP_004969385.1| mitochondrial outer membrane protein porin 3... 69 3e-11 ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane prot... 68 9e-11 ref|XP_006646048.1| PREDICTED: mitochondrial outer membrane prot... 68 9e-11 ref|XP_015611950.1| PREDICTED: mitochondrial outer membrane prot... 68 9e-11 gb|OAY77772.1| Mitochondrial outer membrane protein porin 1 [Ana... 67 9e-11 gb|AQK96318.1| porin1 [Zea mays] 67 1e-10 ref|XP_020099164.1| mitochondrial outer membrane protein porin 1... 67 1e-10 ref|XP_010231957.1| PREDICTED: mitochondrial outer membrane prot... 67 1e-10 ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane prot... 67 1e-10 >gb|ONM40875.1| Mitochondrial outer membrane protein porin 3 [Zea mays] Length = 149 Score = 70.9 bits (172), Expect = 9e-13 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLKH 150 VKARFN+Y A AL+Q+E +PKSF+T+ GEVDTRA+ KS +GLSLVLKH Sbjct: 100 VKARFNNYGMASALVQHEWRPKSFITVSGEVDTRAIEKSTKVGLSLVLKH 149 >gb|ACG25664.1| outer plastidial membrane protein porin [Zea mays] Length = 275 Score = 70.9 bits (172), Expect = 6e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLKH 150 VKARFN+Y A AL+Q+E +PKSF+T+ GEVDTRA+ KS +GLSLVLKH Sbjct: 226 VKARFNNYGMASALVQHEWRPKSFITVSGEVDTRAIEKSTKVGLSLVLKH 275 >ref|NP_001141587.1| outer plastidial membrane protein porin [Zea mays] gb|ACF86667.1| unknown [Zea mays] gb|ONM40874.1| Mitochondrial outer membrane protein porin 3 [Zea mays] Length = 275 Score = 70.9 bits (172), Expect = 6e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLKH 150 VKARFN+Y A AL+Q+E +PKSF+T+ GEVDTRA+ KS +GLSLVLKH Sbjct: 226 VKARFNNYGMASALVQHEWRPKSFITVSGEVDTRAIEKSTKVGLSLVLKH 275 >ref|XP_009408682.1| PREDICTED: mitochondrial outer membrane protein porin 1-like [Musa acuminata subsp. malaccensis] Length = 275 Score = 70.1 bits (170), Expect = 1e-11 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLK 147 +KARFN+Y KA ALIQ+E KPKSF TI GEVDT+A+ KS IGLSLVLK Sbjct: 226 IKARFNNYGKASALIQHEWKPKSFFTISGEVDTKAIEKSSKIGLSLVLK 274 >ref|XP_002458065.1| outer plastidial membrane protein porin [Sorghum bicolor] gb|EES03185.1| hypothetical protein SORBI_3003G201500 [Sorghum bicolor] Length = 275 Score = 70.1 bits (170), Expect = 1e-11 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLKH 150 VKARFN+Y A AL+Q+E +PKSF+TI GEVDT+A+ KS +GLSLVLKH Sbjct: 226 VKARFNNYGMASALVQHEWRPKSFITISGEVDTKAIEKSTKVGLSLVLKH 275 >gb|PAN29987.1| hypothetical protein PAHAL_E02604 [Panicum hallii] Length = 275 Score = 69.7 bits (169), Expect = 2e-11 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLKH 150 VKARFN+Y A AL+Q+E +PKSF+TI GEVDT+A+ KS +GLSLVLKH Sbjct: 226 VKARFNNYGMASALVQHEWRPKSFVTISGEVDTKAIEKSTKVGLSLVLKH 275 >ref|XP_008786741.1| PREDICTED: mitochondrial outer membrane protein porin 1-like [Phoenix dactylifera] Length = 276 Score = 69.3 bits (168), Expect = 2e-11 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLK 147 VKARFN+Y KA ALIQ+E +PKSFLTI GEVDT+A+ KS +GLSLVL+ Sbjct: 227 VKARFNNYGKASALIQHEWRPKSFLTITGEVDTKAIEKSSKVGLSLVLR 275 >gb|OEL19305.1| Mitochondrial outer membrane protein porin 3 [Dichanthelium oligosanthes] Length = 275 Score = 68.9 bits (167), Expect = 3e-11 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLKH 150 VKARFN+Y A AL+Q+E +PKSF+TI GEVDT+A+ KS +GLS+VLKH Sbjct: 226 VKARFNNYGMASALVQHEWRPKSFITISGEVDTKAIEKSTKVGLSVVLKH 275 >ref|XP_010925360.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Elaeis guineensis] Length = 275 Score = 68.9 bits (167), Expect = 3e-11 Identities = 34/49 (69%), Positives = 42/49 (85%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLK 147 VKARFN+Y KA ALIQ+E +PKSFLT+ GEVDT+A+ KS +GLSLVL+ Sbjct: 226 VKARFNNYGKASALIQHEWRPKSFLTVTGEVDTKAIEKSSKVGLSLVLR 274 >ref|XP_010925058.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Elaeis guineensis] Length = 275 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLK 147 VKARFN+Y KA ALIQ+E +PKSF TI GEVDT+A+ KS +GLSLVLK Sbjct: 226 VKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVGLSLVLK 274 >ref|XP_008808420.1| PREDICTED: mitochondrial outer membrane protein porin 1-like [Phoenix dactylifera] Length = 275 Score = 68.9 bits (167), Expect = 3e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLK 147 VKARFN+Y KA ALIQ+E +PKSF TI GEVDT+A+ KS +GLSLVLK Sbjct: 226 VKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVGLSLVLK 274 >ref|XP_004969385.1| mitochondrial outer membrane protein porin 3 [Setaria italica] gb|KQL06209.1| hypothetical protein SETIT_002522mg [Setaria italica] Length = 275 Score = 68.9 bits (167), Expect = 3e-11 Identities = 33/50 (66%), Positives = 42/50 (84%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLKH 150 VKARFN+Y A AL+Q+E +PKSF+TI GEVDT+A+ KS +GLS+VLKH Sbjct: 226 VKARFNNYGMASALVQHEWRPKSFITISGEVDTKAIEKSTKVGLSVVLKH 275 >ref|XP_010932447.1| PREDICTED: mitochondrial outer membrane protein porin 1 [Elaeis guineensis] Length = 275 Score = 67.8 bits (164), Expect = 9e-11 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLK 147 VKARFN+Y KA ALIQ+E +PKSF TI GEVDT+A+ KS +GLSLVL+ Sbjct: 226 VKARFNNYGKASALIQHEWRPKSFFTISGEVDTKAIEKSSKVGLSLVLR 274 >ref|XP_006646048.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Oryza brachyantha] Length = 275 Score = 67.8 bits (164), Expect = 9e-11 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLKH 150 VKARFN+Y A AL+Q+E +PKS +TI GEVDT+A+ KS +GLSLVLKH Sbjct: 226 VKARFNNYGMASALVQHEWRPKSLITISGEVDTKAIEKSTKVGLSLVLKH 275 >ref|XP_015611950.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Oryza sativa Japonica Group] sp|Q7F4F8.1|VDAC3_ORYSJ RecName: Full=Mitochondrial outer membrane protein porin 3; AltName: Full=Voltage-dependent anion-selective channel protein 3; Short=OsVDAC3 emb|CAC80851.1| voltage-dependent anion channel [Oryza sativa Japonica Group] dbj|BAB89921.1| putative porin [Oryza sativa Japonica Group] dbj|BAF05347.1| Os01g0588200 [Oryza sativa Japonica Group] gb|EAY74735.1| hypothetical protein OsI_02626 [Oryza sativa Indica Group] gb|EAZ12509.1| hypothetical protein OsJ_02405 [Oryza sativa Japonica Group] dbj|BAG92122.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAG96666.1| unnamed protein product [Oryza sativa Japonica Group] dbj|BAS72920.1| Os01g0588200 [Oryza sativa Japonica Group] Length = 275 Score = 67.8 bits (164), Expect = 9e-11 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLKH 150 VKARFN+Y A AL+Q+E +PKS +TI GEVDT+A+ KS +GLSLVLKH Sbjct: 226 VKARFNNYGMASALVQHEWRPKSLITISGEVDTKAIEKSTKVGLSLVLKH 275 >gb|OAY77772.1| Mitochondrial outer membrane protein porin 1 [Ananas comosus] Length = 247 Score = 67.4 bits (163), Expect = 9e-11 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLK 147 VKARFN+Y KA ALIQ+E +PKSFLTI EVDT+A+ KS +GLSLVLK Sbjct: 198 VKARFNNYGKASALIQHEWRPKSFLTISTEVDTKAIEKSSKVGLSLVLK 246 >gb|AQK96318.1| porin1 [Zea mays] Length = 211 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/50 (62%), Positives = 41/50 (82%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLKH 150 +K RFN+Y A AL+Q+E +PKSF+TI G+VDT+A+ KS +GLSLVLKH Sbjct: 162 IKTRFNNYGMASALVQHEWRPKSFVTISGDVDTKAIEKSTKVGLSLVLKH 211 >ref|XP_020099164.1| mitochondrial outer membrane protein porin 1-like [Ananas comosus] Length = 273 Score = 67.4 bits (163), Expect = 1e-10 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLK 147 VKARFN+Y KA ALIQ+E +PKSFLTI EVDT+A+ KS +GLSLVLK Sbjct: 224 VKARFNNYGKASALIQHEWRPKSFLTISTEVDTKAIEKSSKVGLSLVLK 272 >ref|XP_010231957.1| PREDICTED: mitochondrial outer membrane protein porin 3 [Brachypodium distachyon] gb|KQK08481.1| hypothetical protein BRADI_2g42137v3 [Brachypodium distachyon] Length = 275 Score = 67.4 bits (163), Expect = 1e-10 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = +1 Query: 1 VKARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLKH 150 VKARFN+Y A AL+Q+E +PKS +TI GEVDT+A+ KS +GLSLVLKH Sbjct: 226 VKARFNNYGMASALVQHEWRPKSLVTISGEVDTKAIEKSTKVGLSLVLKH 275 >ref|XP_009410756.1| PREDICTED: mitochondrial outer membrane protein porin 1-like [Musa acuminata subsp. malaccensis] Length = 275 Score = 67.4 bits (163), Expect = 1e-10 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +1 Query: 4 KARFNSYDKAGALIQYELKPKSFLTIPGEVDTRAV*KS*IIGLSLVLK 147 KARFN+Y KA ALIQ+E KPKSFLTI GEVDT+A+ S IGLSLVL+ Sbjct: 227 KARFNNYGKASALIQHEWKPKSFLTISGEVDTKAIENSSKIGLSLVLR 274