BLASTX nr result
ID: Cheilocostus21_contig00031219
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00031219 (476 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009409740.1| PREDICTED: ribulose bisphosphate carboxylase... 60 2e-08 >ref|XP_009409740.1| PREDICTED: ribulose bisphosphate carboxylase small chain clone 512 [Musa acuminata subsp. malaccensis] Length = 175 Score = 60.5 bits (145), Expect = 2e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +3 Query: 339 MSAGLLPSVAVASCIGRRADASVKLFSQRDTSLLWRSRTVSNGFRT 476 MSA L + AVA +G RADAS KLF ++D S+ WRSRTVSNGFRT Sbjct: 1 MSAAFLSAGAVAGYVGLRADASAKLFPEKDCSIGWRSRTVSNGFRT 46