BLASTX nr result
ID: Cheilocostus21_contig00031160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00031160 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009404770.1| PREDICTED: LON peptidase N-terminal domain a... 119 2e-28 ref|XP_020089912.1| LON peptidase N-terminal domain and RING fin... 95 7e-20 ref|XP_020089903.1| LON peptidase N-terminal domain and RING fin... 95 7e-20 ref|XP_020089893.1| LON peptidase N-terminal domain and RING fin... 95 7e-20 gb|OAY80425.1| LON peptidase N-terminal domain and RING finger p... 95 7e-20 ref|XP_010936520.1| PREDICTED: LON peptidase N-terminal domain a... 93 4e-19 ref|XP_017697789.1| PREDICTED: LON peptidase N-terminal domain a... 84 5e-16 ref|XP_020277272.1| LON peptidase N-terminal domain and RING fin... 80 1e-14 ref|XP_022135219.1| LON peptidase N-terminal domain and RING fin... 79 5e-14 gb|EEE59343.1| hypothetical protein OsJ_11426 [Oryza sativa Japo... 78 7e-14 gb|PAN49043.1| hypothetical protein PAHAL_B00487 [Panicum hallii] 77 2e-13 ref|XP_010258247.1| PREDICTED: LON peptidase N-terminal domain a... 77 2e-13 ref|XP_010258246.1| PREDICTED: LON peptidase N-terminal domain a... 77 2e-13 ref|XP_003562382.1| PREDICTED: LON peptidase N-terminal domain a... 76 4e-13 ref|XP_006376812.1| hypothetical protein POPTR_0012s07000g [Popu... 75 5e-13 ref|XP_006376813.1| hypothetical protein POPTR_0012s07000g [Popu... 75 6e-13 ref|XP_011008743.1| PREDICTED: LON peptidase N-terminal domain a... 75 6e-13 ref|XP_002317975.2| hypothetical protein POPTR_0012s07000g [Popu... 75 6e-13 gb|OEL33819.1| hypothetical protein BAE44_0005160 [Dichanthelium... 75 8e-13 gb|EEC75564.1| hypothetical protein OsI_12235 [Oryza sativa Indi... 75 9e-13 >ref|XP_009404770.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 1 [Musa acuminata subsp. malaccensis] Length = 484 Score = 119 bits (297), Expect = 2e-28 Identities = 59/73 (80%), Positives = 65/73 (89%) Frame = -3 Query: 221 MADPSPRLPGDSQDVEEFPWLEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYS 42 MADPS + DSQDVEEF W+EEAEMG+ VEKF+EVFDLVRRGNRAFRDKRFEEA+S+YS Sbjct: 1 MADPSSQPRADSQDVEEFLWVEEAEMGMPVEKFSEVFDLVRRGNRAFRDKRFEEAVSFYS 60 Query: 41 KALLLKPRDPVIL 3 KA LLKPRD VIL Sbjct: 61 KAQLLKPRDCVIL 73 >ref|XP_020089912.1| LON peptidase N-terminal domain and RING finger protein 3 isoform X3 [Ananas comosus] Length = 478 Score = 95.1 bits (235), Expect = 7e-20 Identities = 49/69 (71%), Positives = 56/69 (81%), Gaps = 1/69 (1%) Frame = -3 Query: 206 PRLPGDSQDVEEFPW-LEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALL 30 P + D DVEEFP +EEAEMG S EK+++VFDLVR GNRAFR KRFEEAIS+YSKA L Sbjct: 15 PPVGDDPNDVEEFPPPVEEAEMGFSAEKYSKVFDLVRSGNRAFRGKRFEEAISFYSKAQL 74 Query: 29 LKPRDPVIL 3 LKP DP+IL Sbjct: 75 LKPGDPIIL 83 >ref|XP_020089903.1| LON peptidase N-terminal domain and RING finger protein 1 isoform X2 [Ananas comosus] Length = 484 Score = 95.1 bits (235), Expect = 7e-20 Identities = 49/69 (71%), Positives = 56/69 (81%), Gaps = 1/69 (1%) Frame = -3 Query: 206 PRLPGDSQDVEEFPW-LEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALL 30 P + D DVEEFP +EEAEMG S EK+++VFDLVR GNRAFR KRFEEAIS+YSKA L Sbjct: 15 PPVGDDPNDVEEFPPPVEEAEMGFSAEKYSKVFDLVRSGNRAFRGKRFEEAISFYSKAQL 74 Query: 29 LKPRDPVIL 3 LKP DP+IL Sbjct: 75 LKPGDPIIL 83 >ref|XP_020089893.1| LON peptidase N-terminal domain and RING finger protein 1 isoform X1 [Ananas comosus] Length = 494 Score = 95.1 bits (235), Expect = 7e-20 Identities = 49/69 (71%), Positives = 56/69 (81%), Gaps = 1/69 (1%) Frame = -3 Query: 206 PRLPGDSQDVEEFPW-LEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALL 30 P + D DVEEFP +EEAEMG S EK+++VFDLVR GNRAFR KRFEEAIS+YSKA L Sbjct: 15 PPVGDDPNDVEEFPPPVEEAEMGFSAEKYSKVFDLVRSGNRAFRGKRFEEAISFYSKAQL 74 Query: 29 LKPRDPVIL 3 LKP DP+IL Sbjct: 75 LKPGDPIIL 83 >gb|OAY80425.1| LON peptidase N-terminal domain and RING finger protein 3 [Ananas comosus] Length = 494 Score = 95.1 bits (235), Expect = 7e-20 Identities = 49/69 (71%), Positives = 56/69 (81%), Gaps = 1/69 (1%) Frame = -3 Query: 206 PRLPGDSQDVEEFPW-LEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALL 30 P + D DVEEFP +EEAEMG S EK+++VFDLVR GNRAFR KRFEEAIS+YSKA L Sbjct: 15 PPVGDDPNDVEEFPPPVEEAEMGFSAEKYSKVFDLVRSGNRAFRGKRFEEAISFYSKAQL 74 Query: 29 LKPRDPVIL 3 LKP DP+IL Sbjct: 75 LKPGDPIIL 83 >ref|XP_010936520.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 1 [Elaeis guineensis] Length = 514 Score = 93.2 bits (230), Expect = 4e-19 Identities = 48/83 (57%), Positives = 61/83 (73%), Gaps = 4/83 (4%) Frame = -3 Query: 239 SPADSHMADPSPRLPGDSQDV----EEFPWLEEAEMGISVEKFAEVFDLVRRGNRAFRDK 72 S + S MA+ S R G+ +++ EEF W+E A MGI ++FA VFDL++ GNRAFRD+ Sbjct: 22 SSSSSPMAESSKRPAGEPREIVAEPEEFLWVEAAAMGIPADRFARVFDLMQVGNRAFRDR 81 Query: 71 RFEEAISYYSKALLLKPRDPVIL 3 RFEEAI+ YSKAL LKP DPVIL Sbjct: 82 RFEEAIASYSKALFLKPEDPVIL 104 >ref|XP_017697789.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 1 [Phoenix dactylifera] Length = 484 Score = 84.3 bits (207), Expect = 5e-16 Identities = 43/77 (55%), Positives = 57/77 (74%), Gaps = 4/77 (5%) Frame = -3 Query: 221 MADPSPRLPGDSQDVE----EFPWLEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAI 54 MA+ S R G+ +++E EF W+ EA M I ++FA+VFDL++ GNRAFR+KRFEEAI Sbjct: 1 MAESSRRPAGEPREIEVELEEFRWVGEAAMEIPADRFAQVFDLMQVGNRAFREKRFEEAI 60 Query: 53 SYYSKALLLKPRDPVIL 3 + YS+A LKP DPVIL Sbjct: 61 ASYSRAQFLKPEDPVIL 77 >ref|XP_020277272.1| LON peptidase N-terminal domain and RING finger protein 1 isoform X1 [Asparagus officinalis] ref|XP_020277273.1| LON peptidase N-terminal domain and RING finger protein 1 isoform X1 [Asparagus officinalis] ref|XP_020277274.1| LON peptidase N-terminal domain and RING finger protein 1 isoform X1 [Asparagus officinalis] ref|XP_020277276.1| LON peptidase N-terminal domain and RING finger protein 1 isoform X1 [Asparagus officinalis] ref|XP_020277277.1| LON peptidase N-terminal domain and RING finger protein 1 isoform X1 [Asparagus officinalis] gb|ONK60037.1| uncharacterized protein A4U43_C08F13540 [Asparagus officinalis] Length = 485 Score = 80.5 bits (197), Expect = 1e-14 Identities = 40/61 (65%), Positives = 50/61 (81%), Gaps = 1/61 (1%) Frame = -3 Query: 182 DVEEFPWLE-EAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVI 6 DVEEF W+E E +MGI E+F+EVF+L+R GNRAFR RFE+A+S+YSKA LLK DP+I Sbjct: 15 DVEEFLWMEDENDMGIPRERFSEVFELMRSGNRAFRAGRFEDAVSFYSKAQLLKSGDPII 74 Query: 5 L 3 L Sbjct: 75 L 75 >ref|XP_022135219.1| LON peptidase N-terminal domain and RING finger protein 1 [Momordica charantia] Length = 489 Score = 78.6 bits (192), Expect = 5e-14 Identities = 38/74 (51%), Positives = 52/74 (70%), Gaps = 1/74 (1%) Frame = -3 Query: 221 MADPSPRLPGDSQ-DVEEFPWLEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYY 45 MA+PS LP DS D++++ W E E + + F+ VF+ V++GN+AFRD FEEAI YY Sbjct: 1 MAEPSSSLPMDSLGDIDDYIWANEGEGSLPWDMFSHVFEFVQKGNQAFRDSHFEEAIKYY 60 Query: 44 SKALLLKPRDPVIL 3 S+A +KP DPVIL Sbjct: 61 SRANNIKPGDPVIL 74 >gb|EEE59343.1| hypothetical protein OsJ_11426 [Oryza sativa Japonica Group] Length = 640 Score = 78.2 bits (191), Expect = 7e-14 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 1/60 (1%) Frame = -3 Query: 179 VEEFPWLE-EAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVIL 3 VE+FPW++ E EMG+ +K+ EVFDL +RG RAFRD F+EA+S+YSKA L+P DP+IL Sbjct: 15 VEDFPWVKREEEMGMDPDKYREVFDLAQRGARAFRDGHFDEAVSFYSKAQTLRPGDPIIL 74 >gb|PAN49043.1| hypothetical protein PAHAL_B00487 [Panicum hallii] Length = 480 Score = 77.0 bits (188), Expect = 2e-13 Identities = 37/59 (62%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Frame = -3 Query: 176 EEFPWLEEAE-MGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVIL 3 E+FP +E E MG++ +K+ EVFDL +RG RAFRD+RF+EAIS+YSKAL L+P DP+IL Sbjct: 15 EDFPLVEGQEGMGMAPDKYREVFDLAQRGTRAFRDRRFDEAISFYSKALNLRPGDPIIL 73 >ref|XP_010258247.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 1 isoform X2 [Nelumbo nucifera] Length = 447 Score = 76.6 bits (187), Expect = 2e-13 Identities = 36/60 (60%), Positives = 45/60 (75%) Frame = -3 Query: 182 DVEEFPWLEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVIL 3 DVEEF W E E +S ++F +VFDL+++GNRAFR+ R E+AISYY KA KP DPVIL Sbjct: 17 DVEEFVWASEGETNMSWDRFGQVFDLMQKGNRAFREGRIEDAISYYYKAHNFKPGDPVIL 76 >ref|XP_010258246.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 1 isoform X1 [Nelumbo nucifera] Length = 487 Score = 76.6 bits (187), Expect = 2e-13 Identities = 36/60 (60%), Positives = 45/60 (75%) Frame = -3 Query: 182 DVEEFPWLEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVIL 3 DVEEF W E E +S ++F +VFDL+++GNRAFR+ R E+AISYY KA KP DPVIL Sbjct: 17 DVEEFVWASEGETNMSWDRFGQVFDLMQKGNRAFREGRIEDAISYYYKAHNFKPGDPVIL 76 >ref|XP_003562382.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 1 [Brachypodium distachyon] gb|KQK14414.1| hypothetical protein BRADI_1g16075v3 [Brachypodium distachyon] Length = 480 Score = 75.9 bits (185), Expect = 4e-13 Identities = 37/60 (61%), Positives = 48/60 (80%), Gaps = 1/60 (1%) Frame = -3 Query: 179 VEEFPWLEEAEM-GISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVIL 3 VE+FPW E EM G++ +K+ EVFDL +RG RAFR++RF+EAIS+YSKA L+ DPVIL Sbjct: 14 VEDFPWAEREEMMGMAPDKYREVFDLAQRGARAFRERRFDEAISFYSKAHNLRSGDPVIL 73 >ref|XP_006376812.1| hypothetical protein POPTR_0012s07000g [Populus trichocarpa] gb|PNT09856.1| hypothetical protein POPTR_012G068100v3 [Populus trichocarpa] Length = 402 Score = 75.5 bits (184), Expect = 5e-13 Identities = 34/60 (56%), Positives = 45/60 (75%) Frame = -3 Query: 182 DVEEFPWLEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVIL 3 DVEEF W E E + ++F+ VFDLV+ GN+AFR+ FEEAI+YYS+A +KP DP+IL Sbjct: 19 DVEEFIWANEGEGSLPWDRFSHVFDLVQNGNKAFRENHFEEAINYYSRANNIKPGDPIIL 78 >ref|XP_006376813.1| hypothetical protein POPTR_0012s07000g [Populus trichocarpa] gb|PNT09857.1| hypothetical protein POPTR_012G068100v3 [Populus trichocarpa] Length = 484 Score = 75.5 bits (184), Expect = 6e-13 Identities = 34/60 (56%), Positives = 45/60 (75%) Frame = -3 Query: 182 DVEEFPWLEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVIL 3 DVEEF W E E + ++F+ VFDLV+ GN+AFR+ FEEAI+YYS+A +KP DP+IL Sbjct: 19 DVEEFIWANEGEGSLPWDRFSHVFDLVQNGNKAFRENHFEEAINYYSRANNIKPGDPIIL 78 >ref|XP_011008743.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 2 [Populus euphratica] ref|XP_011008744.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 2 [Populus euphratica] ref|XP_011008745.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 2 [Populus euphratica] Length = 487 Score = 75.5 bits (184), Expect = 6e-13 Identities = 34/60 (56%), Positives = 45/60 (75%) Frame = -3 Query: 182 DVEEFPWLEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVIL 3 DVEEF W E E + ++F+ VFDLV+ GN+AFR+ FEEAI+YYS+A +KP DP+IL Sbjct: 19 DVEEFIWANEGEGSLPWDRFSHVFDLVQNGNKAFRENHFEEAINYYSRANNIKPGDPIIL 78 >ref|XP_002317975.2| hypothetical protein POPTR_0012s07000g [Populus trichocarpa] gb|PNT09858.1| hypothetical protein POPTR_012G068100v3 [Populus trichocarpa] Length = 487 Score = 75.5 bits (184), Expect = 6e-13 Identities = 34/60 (56%), Positives = 45/60 (75%) Frame = -3 Query: 182 DVEEFPWLEEAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVIL 3 DVEEF W E E + ++F+ VFDLV+ GN+AFR+ FEEAI+YYS+A +KP DP+IL Sbjct: 19 DVEEFIWANEGEGSLPWDRFSHVFDLVQNGNKAFRENHFEEAINYYSRANNIKPGDPIIL 78 >gb|OEL33819.1| hypothetical protein BAE44_0005160 [Dichanthelium oligosanthes] Length = 456 Score = 75.1 bits (183), Expect = 8e-13 Identities = 33/59 (55%), Positives = 48/59 (81%), Gaps = 1/59 (1%) Frame = -3 Query: 176 EEFPWLEEAE-MGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVIL 3 E+FPW+E E MG++ +K+ EVFDL +RG +AFR++RF+EA+ +YSKA+ L+P DP IL Sbjct: 15 EDFPWVESPEEMGMAADKYREVFDLAQRGTQAFRERRFDEALPFYSKAINLRPGDPSIL 73 >gb|EEC75564.1| hypothetical protein OsI_12235 [Oryza sativa Indica Group] Length = 640 Score = 75.1 bits (183), Expect = 9e-13 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 1/60 (1%) Frame = -3 Query: 179 VEEFPWLE-EAEMGISVEKFAEVFDLVRRGNRAFRDKRFEEAISYYSKALLLKPRDPVIL 3 VE+FPW++ E EMG+ +K+ EVFDL +RG RAFRD F+EA+S+YSKA L+P D +IL Sbjct: 15 VEDFPWVKREEEMGMDPDKYREVFDLAQRGARAFRDGHFDEAVSFYSKAQTLRPGDSIIL 74