BLASTX nr result
ID: Cheilocostus21_contig00030590
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00030590 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009395893.1| PREDICTED: growth hormone-regulated TBC prot... 59 3e-07 >ref|XP_009395893.1| PREDICTED: growth hormone-regulated TBC protein 1-like [Musa acuminata subsp. malaccensis] Length = 431 Score = 58.5 bits (140), Expect = 3e-07 Identities = 30/43 (69%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = -1 Query: 128 RMFGAQ-DREAPNKFAPRRRPYWITSAISNPRPTTITSSIPKK 3 RMFGAQ RE + F P RRPYWITSA R TTITSSIPKK Sbjct: 21 RMFGAQAQREVSDGFVPTRRPYWITSATPGSRATTITSSIPKK 63