BLASTX nr result
ID: Cheilocostus21_contig00030265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00030265 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA09137.1| hypothetical protein SOVF_154760 [Spinacia oleracea] 90 3e-20 ref|XP_011030296.1| PREDICTED: probable zinc metallopeptidase EG... 96 4e-20 ref|XP_002298792.2| hypothetical protein POPTR_0001s29700g [Popu... 96 4e-20 ref|XP_011030291.1| PREDICTED: probable zinc metallopeptidase EG... 96 4e-20 ref|XP_011014535.1| PREDICTED: probable zinc metallopeptidase EG... 96 4e-20 ref|XP_002298791.2| hypothetical protein POPTR_0001s29700g [Popu... 96 4e-20 ref|XP_011014533.1| PREDICTED: probable zinc metallopeptidase EG... 96 4e-20 ref|XP_013641738.1| probable zinc metallopeptidase EGY3, chlorop... 94 1e-19 ref|XP_009149239.1| PREDICTED: probable zinc metallopeptidase EG... 94 1e-19 emb|CDY26208.1| BnaA06g12090D [Brassica napus] 94 1e-19 gb|PKI71615.1| hypothetical protein CRG98_007938 [Punica granatum] 94 1e-19 ref|NP_173229.1| ethylene-dependent gravitropism-deficient and y... 94 1e-19 dbj|BAE98423.1| hypothetical protein [Arabidopsis thaliana] 94 1e-19 ref|XP_010065858.1| PREDICTED: probable zinc metallopeptidase EG... 94 1e-19 gb|PIN07630.1| hypothetical protein CDL12_19798 [Handroanthus im... 94 1e-19 gb|OWM64774.1| hypothetical protein CDL15_Pgr028491 [Punica gran... 94 1e-19 ref|XP_021823309.1| probable zinc metallopeptidase EGY3, chlorop... 94 1e-19 ref|XP_008236259.1| PREDICTED: probable zinc metallopeptidase EG... 94 1e-19 gb|OMO73830.1| hypothetical protein CCACVL1_17116 [Corchorus cap... 94 1e-19 gb|OMO63415.1| hypothetical protein COLO4_32484 [Corchorus olito... 94 1e-19 >gb|KNA09137.1| hypothetical protein SOVF_154760 [Spinacia oleracea] Length = 135 Score = 89.7 bits (221), Expect = 3e-20 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSV+CLAWGLFATFFRGGEE PAKDEITP+GDDR +WG Sbjct: 57 LLGIGGLSGSVICLAWGLFATFFRGGEENPAKDEITPLGDDRYSWG 102 >ref|XP_011030296.1| PREDICTED: probable zinc metallopeptidase EGY3, chloroplastic isoform X2 [Populus euphratica] Length = 587 Score = 95.5 bits (236), Expect = 4e-20 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDRLAWG Sbjct: 509 LLGIGGLSGSVLCLAWGLFATFFRGGEEIPAKDEITPLGDDRLAWG 554 >ref|XP_002298792.2| hypothetical protein POPTR_0001s29700g [Populus trichocarpa] gb|PNT57263.1| hypothetical protein POPTR_001G289700v3 [Populus trichocarpa] Length = 592 Score = 95.5 bits (236), Expect = 4e-20 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDRLAWG Sbjct: 514 LLGIGGLSGSVLCLAWGLFATFFRGGEEIPAKDEITPLGDDRLAWG 559 >ref|XP_011030291.1| PREDICTED: probable zinc metallopeptidase EGY3, chloroplastic isoform X1 [Populus euphratica] ref|XP_011030292.1| PREDICTED: probable zinc metallopeptidase EGY3, chloroplastic isoform X1 [Populus euphratica] ref|XP_011030294.1| PREDICTED: probable zinc metallopeptidase EGY3, chloroplastic isoform X1 [Populus euphratica] ref|XP_011030295.1| PREDICTED: probable zinc metallopeptidase EGY3, chloroplastic isoform X1 [Populus euphratica] Length = 594 Score = 95.5 bits (236), Expect = 4e-20 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDRLAWG Sbjct: 516 LLGIGGLSGSVLCLAWGLFATFFRGGEEIPAKDEITPLGDDRLAWG 561 >ref|XP_011014535.1| PREDICTED: probable zinc metallopeptidase EGY3, chloroplastic isoform X2 [Populus euphratica] Length = 623 Score = 95.5 bits (236), Expect = 4e-20 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDRLAWG Sbjct: 545 LLGIGGLSGSVLCLAWGLFATFFRGGEEIPAKDEITPLGDDRLAWG 590 >ref|XP_002298791.2| hypothetical protein POPTR_0001s29700g [Populus trichocarpa] gb|PNT57264.1| hypothetical protein POPTR_001G289700v3 [Populus trichocarpa] Length = 623 Score = 95.5 bits (236), Expect = 4e-20 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDRLAWG Sbjct: 545 LLGIGGLSGSVLCLAWGLFATFFRGGEEIPAKDEITPLGDDRLAWG 590 >ref|XP_011014533.1| PREDICTED: probable zinc metallopeptidase EGY3, chloroplastic isoform X1 [Populus euphratica] ref|XP_011014534.1| PREDICTED: probable zinc metallopeptidase EGY3, chloroplastic isoform X1 [Populus euphratica] Length = 630 Score = 95.5 bits (236), Expect = 4e-20 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDRLAWG Sbjct: 552 LLGIGGLSGSVLCLAWGLFATFFRGGEEIPAKDEITPLGDDRLAWG 597 >ref|XP_013641738.1| probable zinc metallopeptidase EGY3, chloroplastic [Brassica napus] Length = 572 Score = 94.4 bits (233), Expect = 1e-19 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LLAIGGLSGSVLCLAWGLFATFFRGGEE PAKDEITP+GDDR AWG Sbjct: 493 LLAIGGLSGSVLCLAWGLFATFFRGGEETPAKDEITPLGDDRFAWG 538 >ref|XP_009149239.1| PREDICTED: probable zinc metallopeptidase EGY3, chloroplastic [Brassica rapa] Length = 572 Score = 94.4 bits (233), Expect = 1e-19 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LLAIGGLSGSVLCLAWGLFATFFRGGEE PAKDEITP+GDDR AWG Sbjct: 493 LLAIGGLSGSVLCLAWGLFATFFRGGEETPAKDEITPLGDDRFAWG 538 >emb|CDY26208.1| BnaA06g12090D [Brassica napus] Length = 572 Score = 94.4 bits (233), Expect = 1e-19 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LLAIGGLSGSVLCLAWGLFATFFRGGEE PAKDEITP+GDDR AWG Sbjct: 493 LLAIGGLSGSVLCLAWGLFATFFRGGEETPAKDEITPLGDDRFAWG 538 >gb|PKI71615.1| hypothetical protein CRG98_007938 [Punica granatum] Length = 456 Score = 94.0 bits (232), Expect = 1e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDR AWG Sbjct: 378 LLGIGGLSGSVLCLAWGLFATFFRGGEEIPAKDEITPLGDDRFAWG 423 >ref|NP_173229.1| ethylene-dependent gravitropism-deficient and yellow-green-like 3 [Arabidopsis thaliana] sp|Q9LMU1.1|EGY3_ARATH RecName: Full=Probable zinc metallopeptidase EGY3, chloroplastic; AltName: Full=Protein ETHYLENE-DEPENDENT GRAVITROPISM-DEFICIENT AND YELLOW-GREEN 3; Short=AtEGY3; Flags: Precursor gb|AAF97267.1|AC034106_10 F2H15.10 [Arabidopsis thaliana] gb|AEE29646.1| ethylene-dependent gravitropism-deficient and yellow-green-like 3 [Arabidopsis thaliana] Length = 573 Score = 94.0 bits (232), Expect = 1e-19 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE PAKDEITPVGDDR AWG Sbjct: 494 LLGIGGLSGSVLCLAWGLFATFFRGGEETPAKDEITPVGDDRFAWG 539 >dbj|BAE98423.1| hypothetical protein [Arabidopsis thaliana] Length = 573 Score = 94.0 bits (232), Expect = 1e-19 Identities = 43/46 (93%), Positives = 43/46 (93%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE PAKDEITPVGDDR AWG Sbjct: 494 LLGIGGLSGSVLCLAWGLFATFFRGGEETPAKDEITPVGDDRFAWG 539 >ref|XP_010065858.1| PREDICTED: probable zinc metallopeptidase EGY3, chloroplastic [Eucalyptus grandis] gb|KCW63556.1| hypothetical protein EUGRSUZ_G01188 [Eucalyptus grandis] Length = 575 Score = 94.0 bits (232), Expect = 1e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDR AWG Sbjct: 497 LLGIGGLSGSVLCLAWGLFATFFRGGEEIPAKDEITPLGDDRFAWG 542 >gb|PIN07630.1| hypothetical protein CDL12_19798 [Handroanthus impetiginosus] Length = 579 Score = 94.0 bits (232), Expect = 1e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDR AWG Sbjct: 501 LLGIGGLSGSVLCLAWGLFATFFRGGEEIPAKDEITPLGDDRFAWG 546 >gb|OWM64774.1| hypothetical protein CDL15_Pgr028491 [Punica granatum] Length = 581 Score = 94.0 bits (232), Expect = 1e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDR AWG Sbjct: 503 LLGIGGLSGSVLCLAWGLFATFFRGGEEIPAKDEITPLGDDRFAWG 548 >ref|XP_021823309.1| probable zinc metallopeptidase EGY3, chloroplastic [Prunus avium] Length = 584 Score = 94.0 bits (232), Expect = 1e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDR AWG Sbjct: 506 LLGIGGLSGSVLCLAWGLFATFFRGGEEMPAKDEITPLGDDRFAWG 551 >ref|XP_008236259.1| PREDICTED: probable zinc metallopeptidase EGY3, chloroplastic [Prunus mume] Length = 584 Score = 94.0 bits (232), Expect = 1e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDR AWG Sbjct: 506 LLGIGGLSGSVLCLAWGLFATFFRGGEEMPAKDEITPLGDDRFAWG 551 >gb|OMO73830.1| hypothetical protein CCACVL1_17116 [Corchorus capsularis] Length = 615 Score = 94.0 bits (232), Expect = 1e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDR AWG Sbjct: 537 LLGIGGLSGSVLCLAWGLFATFFRGGEEMPAKDEITPLGDDRFAWG 582 >gb|OMO63415.1| hypothetical protein COLO4_32484 [Corchorus olitorius] Length = 615 Score = 94.0 bits (232), Expect = 1e-19 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 417 LLAIGGLSGSVLCLAWGLFATFFRGGEELPAKDEITPVGDDRLAWG 280 LL IGGLSGSVLCLAWGLFATFFRGGEE+PAKDEITP+GDDR AWG Sbjct: 537 LLGIGGLSGSVLCLAWGLFATFFRGGEEMPAKDEITPLGDDRFAWG 582