BLASTX nr result
ID: Cheilocostus21_contig00030155
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00030155 (738 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_018684494.1| PREDICTED: uncharacterized protein LOC108953... 78 6e-15 >ref|XP_018684494.1| PREDICTED: uncharacterized protein LOC108953394 [Musa acuminata subsp. malaccensis] Length = 101 Score = 78.2 bits (191), Expect = 6e-15 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 462 SADVAIVHRRGCGLKQAHLCGFLTPAEKNESLVDDDKRIVPTGPNPLHNR 611 +ADV +H C LK+ LC + TPAEKNESLV+DDKR+VPTGPNPLHNR Sbjct: 52 AADVVTIHPHRCKLKRFDLCSYFTPAEKNESLVEDDKRLVPTGPNPLHNR 101