BLASTX nr result
ID: Cheilocostus21_contig00030104
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00030104 (514 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009384821.1| PREDICTED: uncharacterized protein LOC103972... 56 5e-06 >ref|XP_009384821.1| PREDICTED: uncharacterized protein LOC103972263 [Musa acuminata subsp. malaccensis] Length = 969 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = +3 Query: 54 TWEIMLMLVERRIEQNIGKAEDKAVDLKWLNLGDHVDEVGMQIQ 185 TW+ MLVE+R+E + G AEDK +D+KWL+LGD +DEVG++I+ Sbjct: 911 TWQ---MLVEKRMELSGGNAEDKVLDIKWLDLGDDIDEVGVEIE 951