BLASTX nr result
ID: Cheilocostus21_contig00029775
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00029775 (506 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009402444.1| PREDICTED: uncharacterized protein LOC103986... 60 3e-07 ref|XP_009402443.1| PREDICTED: uncharacterized protein LOC103986... 60 3e-07 >ref|XP_009402444.1| PREDICTED: uncharacterized protein LOC103986229 isoform X2 [Musa acuminata subsp. malaccensis] Length = 927 Score = 59.7 bits (143), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 148 RWEDHGRPPGGDNSAIVDTGVIRQGIVFTL 237 RWE+HGRPPGGDNSAI DTG IR GIVFT+ Sbjct: 253 RWENHGRPPGGDNSAIADTGAIRPGIVFTI 282 >ref|XP_009402443.1| PREDICTED: uncharacterized protein LOC103986229 isoform X1 [Musa acuminata subsp. malaccensis] Length = 939 Score = 59.7 bits (143), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +1 Query: 148 RWEDHGRPPGGDNSAIVDTGVIRQGIVFTL 237 RWE+HGRPPGGDNSAI DTG IR GIVFT+ Sbjct: 253 RWENHGRPPGGDNSAIADTGAIRPGIVFTI 282