BLASTX nr result
ID: Cheilocostus21_contig00029463
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00029463 (478 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021608253.1| methyltransferase-like protein 5 [Manihot es... 80 3e-15 gb|PPR84134.1| hypothetical protein GOBAR_AA36579 [Gossypium bar... 80 3e-15 ref|XP_020694301.1| methyltransferase-like protein 5 [Dendrobium... 75 8e-15 ref|XP_018814998.1| PREDICTED: methyltransferase-like protein 5 ... 78 8e-15 gb|PIA64836.1| hypothetical protein AQUCO_00100363v1 [Aquilegia ... 78 1e-14 ref|XP_018814992.1| PREDICTED: methyltransferase-like protein 5 ... 78 1e-14 ref|XP_018814986.1| PREDICTED: methyltransferase-like protein 5 ... 78 1e-14 ref|XP_018814977.1| PREDICTED: methyltransferase-like protein 5 ... 78 1e-14 ref|XP_021741471.1| methyltransferase-like protein 5 [Chenopodiu... 78 1e-14 ref|XP_021723603.1| methyltransferase-like protein 5 [Chenopodiu... 78 1e-14 ref|XP_003589700.2| S-adenosylmethionine-dependent methyltransfe... 78 1e-14 ref|XP_010688262.1| PREDICTED: methyltransferase-like protein 5 ... 78 1e-14 ref|XP_022755014.1| methyltransferase-like protein 5 isoform X4 ... 77 2e-14 ref|XP_021277470.1| methyltransferase-like protein 5 isoform X2 ... 77 2e-14 ref|XP_022755013.1| methyltransferase-like protein 5 isoform X3 ... 77 2e-14 ref|XP_021277469.1| methyltransferase-like protein 5 isoform X1 ... 77 2e-14 ref|XP_007013103.2| PREDICTED: methyltransferase-like protein 5 ... 77 2e-14 ref|XP_012076739.1| methyltransferase-like protein 5 isoform X2 ... 77 2e-14 gb|EOY30722.1| S-adenosyl-L-methionine-dependent methyltransfera... 77 2e-14 ref|XP_022755012.1| methyltransferase-like protein 5 isoform X2 ... 77 2e-14 >ref|XP_021608253.1| methyltransferase-like protein 5 [Manihot esculenta] gb|OAY53793.1| hypothetical protein MANES_03G024000 [Manihot esculenta] Length = 213 Score = 79.7 bits (195), Expect = 3e-15 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP ++QG Sbjct: 171 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKSSQG 210 >gb|PPR84134.1| hypothetical protein GOBAR_AA36579 [Gossypium barbadense] Length = 217 Score = 79.7 bits (195), Expect = 3e-15 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQGTVAGMTE 144 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP +Q V G+ + Sbjct: 171 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKRSQVGVTGVVD 217 >ref|XP_020694301.1| methyltransferase-like protein 5 [Dendrobium catenatum] ref|XP_020694302.1| methyltransferase-like protein 5 [Dendrobium catenatum] ref|XP_020694303.1| methyltransferase-like protein 5 [Dendrobium catenatum] gb|PKU83785.1| hypothetical protein MA16_Dca010878 [Dendrobium catenatum] Length = 86 Score = 75.1 bits (183), Expect = 8e-15 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVP 108 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP Sbjct: 52 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVP 86 >ref|XP_018814998.1| PREDICTED: methyltransferase-like protein 5 isoform X4 [Juglans regia] Length = 203 Score = 78.2 bits (191), Expect = 8e-15 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP QG Sbjct: 152 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKGNQG 191 >gb|PIA64836.1| hypothetical protein AQUCO_00100363v1 [Aquilegia coerulea] Length = 212 Score = 78.2 bits (191), Expect = 1e-14 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = +1 Query: 1 RNAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQGTV 129 R+AEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVP Q V Sbjct: 170 RSAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPQKNQERV 212 >ref|XP_018814992.1| PREDICTED: methyltransferase-like protein 5 isoform X3 [Juglans regia] Length = 215 Score = 78.2 bits (191), Expect = 1e-14 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP QG Sbjct: 164 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKGNQG 203 >ref|XP_018814986.1| PREDICTED: methyltransferase-like protein 5 isoform X2 [Juglans regia] Length = 221 Score = 78.2 bits (191), Expect = 1e-14 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP QG Sbjct: 170 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKGNQG 209 >ref|XP_018814977.1| PREDICTED: methyltransferase-like protein 5 isoform X1 [Juglans regia] Length = 222 Score = 78.2 bits (191), Expect = 1e-14 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP QG Sbjct: 171 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKGNQG 210 >ref|XP_021741471.1| methyltransferase-like protein 5 [Chenopodium quinoa] Length = 213 Score = 77.8 bits (190), Expect = 1e-14 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 1 RNAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 ++AEVLCELR+DVPQLYKFHKKKEVD+AVDLWRFVP A G Sbjct: 170 KSAEVLCELRYDVPQLYKFHKKKEVDIAVDLWRFVPTPAAG 210 >ref|XP_021723603.1| methyltransferase-like protein 5 [Chenopodium quinoa] Length = 213 Score = 77.8 bits (190), Expect = 1e-14 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 1 RNAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 ++AEVLCELR+DVPQLYKFHKKKEVD+AVDLWRFVP A G Sbjct: 170 KSAEVLCELRYDVPQLYKFHKKKEVDIAVDLWRFVPTPAAG 210 >ref|XP_003589700.2| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula] gb|AES59951.2| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula] Length = 213 Score = 77.8 bits (190), Expect = 1e-14 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 1 RNAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQ 120 R+AEV+CELRFDVP+LYKFHKKKEVD+AVDLWRFVPA+ Q Sbjct: 170 RSAEVICELRFDVPKLYKFHKKKEVDIAVDLWRFVPASHQ 209 >ref|XP_010688262.1| PREDICTED: methyltransferase-like protein 5 [Beta vulgaris subsp. vulgaris] gb|KMT03132.1| hypothetical protein BVRB_8g196890 [Beta vulgaris subsp. vulgaris] Length = 216 Score = 77.8 bits (190), Expect = 1e-14 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +1 Query: 1 RNAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 R+AEVLCELR+DVP+LYKFH+KKEVD+AVDLWRFVPA A G Sbjct: 170 RSAEVLCELRYDVPKLYKFHRKKEVDIAVDLWRFVPAKAAG 210 >ref|XP_022755014.1| methyltransferase-like protein 5 isoform X4 [Durio zibethinus] Length = 203 Score = 77.4 bits (189), Expect = 2e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP ++G Sbjct: 152 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKRSRG 191 >ref|XP_021277470.1| methyltransferase-like protein 5 isoform X2 [Herrania umbratica] Length = 208 Score = 77.4 bits (189), Expect = 2e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP ++G Sbjct: 166 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKRSRG 205 >ref|XP_022755013.1| methyltransferase-like protein 5 isoform X3 [Durio zibethinus] Length = 213 Score = 77.4 bits (189), Expect = 2e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP ++G Sbjct: 162 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKRSRG 201 >ref|XP_021277469.1| methyltransferase-like protein 5 isoform X1 [Herrania umbratica] Length = 213 Score = 77.4 bits (189), Expect = 2e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP ++G Sbjct: 171 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKRSRG 210 >ref|XP_007013103.2| PREDICTED: methyltransferase-like protein 5 [Theobroma cacao] Length = 213 Score = 77.4 bits (189), Expect = 2e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP ++G Sbjct: 171 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKRSRG 210 >ref|XP_012076739.1| methyltransferase-like protein 5 isoform X2 [Jatropha curcas] gb|KDP33707.1| hypothetical protein JCGZ_07278 [Jatropha curcas] Length = 213 Score = 77.4 bits (189), Expect = 2e-14 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFD+PQLYKFHKK+EVD+AVDLWRFVP ++QG Sbjct: 171 SAEVLCELRFDLPQLYKFHKKREVDIAVDLWRFVPKSSQG 210 >gb|EOY30722.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily protein [Theobroma cacao] Length = 213 Score = 77.4 bits (189), Expect = 2e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP ++G Sbjct: 171 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKRSRG 210 >ref|XP_022755012.1| methyltransferase-like protein 5 isoform X2 [Durio zibethinus] Length = 217 Score = 77.4 bits (189), Expect = 2e-14 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +1 Query: 4 NAEVLCELRFDVPQLYKFHKKKEVDVAVDLWRFVPAAAQG 123 +AEVLCELRFDVPQLYKFHKKKEVD+AVDLWRFVP ++G Sbjct: 166 SAEVLCELRFDVPQLYKFHKKKEVDIAVDLWRFVPKRSRG 205