BLASTX nr result
ID: Cheilocostus21_contig00029422
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00029422 (846 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008779612.1| PREDICTED: probable cyclic nucleotide-gated ... 82 1e-13 ref|XP_010914081.1| PREDICTED: probable cyclic nucleotide-gated ... 80 4e-13 gb|OMO94157.1| putative cyclic nucleotide-gated ion channel 14-l... 70 4e-12 ref|XP_010929224.1| PREDICTED: probable cyclic nucleotide-gated ... 77 5e-12 ref|XP_010929223.1| PREDICTED: probable cyclic nucleotide-gated ... 77 6e-12 ref|XP_009399588.1| PREDICTED: cyclic nucleotide-gated ion chann... 75 3e-11 ref|XP_009780885.1| PREDICTED: probable cyclic nucleotide-gated ... 73 5e-11 ref|XP_010048698.1| PREDICTED: cyclic nucleotide-gated ion chann... 74 6e-11 ref|XP_008794413.1| PREDICTED: probable cyclic nucleotide-gated ... 74 6e-11 ref|XP_010048696.1| PREDICTED: cyclic nucleotide-gated ion chann... 74 6e-11 ref|XP_011082041.1| probable cyclic nucleotide-gated ion channel... 73 1e-10 ref|XP_016484430.1| PREDICTED: probable cyclic nucleotide-gated ... 73 1e-10 ref|XP_009593887.1| PREDICTED: probable cyclic nucleotide-gated ... 73 1e-10 ref|XP_016464534.1| PREDICTED: probable cyclic nucleotide-gated ... 73 1e-10 ref|XP_024033411.1| cyclic nucleotide-gated ion channel 17 isofo... 72 1e-10 ref|XP_006453463.1| cyclic nucleotide-gated ion channel 17 isofo... 72 1e-10 dbj|GAY48452.1| hypothetical protein CUMW_111750 [Citrus unshiu] 72 2e-10 gb|KDO62388.1| hypothetical protein CISIN_1g004506mg [Citrus sin... 72 2e-10 ref|XP_020080387.1| cyclic nucleotide-gated ion channel 17-like ... 72 2e-10 gb|OAY78401.1| putative cyclic nucleotide-gated ion channel 14 [... 72 2e-10 >ref|XP_008779612.1| PREDICTED: probable cyclic nucleotide-gated ion channel 14 [Phoenix dactylifera] Length = 709 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADPY 717 NLGVTILASKFAASTRKGAQK KG++MPKLQKP++PDFSADPY Sbjct: 666 NLGVTILASKFAASTRKGAQKIKGIDMPKLQKPDEPDFSADPY 708 >ref|XP_010914081.1| PREDICTED: probable cyclic nucleotide-gated ion channel 14 [Elaeis guineensis] Length = 722 Score = 80.1 bits (196), Expect = 4e-13 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADPY 717 NLGVTILASKFAASTRKG QK KG++MPKLQKP++PDFSADPY Sbjct: 679 NLGVTILASKFAASTRKGVQKIKGIDMPKLQKPDEPDFSADPY 721 >gb|OMO94157.1| putative cyclic nucleotide-gated ion channel 14-like protein [Corchorus capsularis] gb|OMO95103.1| putative cyclic nucleotide-gated ion channel 14-like protein [Corchorus olitorius] Length = 73 Score = 70.5 bits (171), Expect = 4e-12 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADP 720 NLGVTILAS+FAA+TR+GAQK K + MPKLQKPE+PDFS +P Sbjct: 29 NLGVTILASRFAANTRRGAQKLKDVGMPKLQKPEEPDFSTEP 70 >ref|XP_010929224.1| PREDICTED: probable cyclic nucleotide-gated ion channel 14 isoform X2 [Elaeis guineensis] Length = 653 Score = 76.6 bits (187), Expect = 5e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADPY 717 NLGV ILASKFAASTRKGAQK KG++MPKLQKP +PDFSADP+ Sbjct: 610 NLGVMILASKFAASTRKGAQKIKGIDMPKLQKPAEPDFSADPF 652 >ref|XP_010929223.1| PREDICTED: probable cyclic nucleotide-gated ion channel 14 isoform X1 [Elaeis guineensis] Length = 724 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADPY 717 NLGV ILASKFAASTRKGAQK KG++MPKLQKP +PDFSADP+ Sbjct: 681 NLGVMILASKFAASTRKGAQKIKGIDMPKLQKPAEPDFSADPF 723 >ref|XP_009399588.1| PREDICTED: cyclic nucleotide-gated ion channel 17 [Musa acuminata subsp. malaccensis] Length = 717 Score = 74.7 bits (182), Expect = 3e-11 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADPY 717 NLGVTILASKFAA+TRKGAQK KG++MPKLQKP++PDFS++ Y Sbjct: 674 NLGVTILASKFAATTRKGAQKIKGIDMPKLQKPDEPDFSSETY 716 >ref|XP_009780885.1| PREDICTED: probable cyclic nucleotide-gated ion channel 14 [Nicotiana sylvestris] Length = 331 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADP 720 NLGVTILAS+FAA+TR+GAQK K M++PKLQKPE+PDFSA+P Sbjct: 287 NLGVTILASRFAANTRRGAQKMKDMDLPKLQKPEEPDFSAEP 328 >ref|XP_010048698.1| PREDICTED: cyclic nucleotide-gated ion channel 17 isoform X2 [Eucalyptus grandis] ref|XP_018726533.1| PREDICTED: cyclic nucleotide-gated ion channel 17 isoform X2 [Eucalyptus grandis] gb|KCW81066.1| hypothetical protein EUGRSUZ_C02438 [Eucalyptus grandis] Length = 691 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADPY 717 NLGVTILAS+FAA+TR+GAQK K + MPKLQKPE+PDFS++PY Sbjct: 647 NLGVTILASRFAANTRRGAQKIKDVEMPKLQKPEEPDFSSEPY 689 >ref|XP_008794413.1| PREDICTED: probable cyclic nucleotide-gated ion channel 14 [Phoenix dactylifera] Length = 722 Score = 73.6 bits (179), Expect = 6e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADPY 717 NL V ILASKFAASTRKGAQK KG++MPKLQKP++PDFSA PY Sbjct: 679 NLEVMILASKFAASTRKGAQKIKGIDMPKLQKPDEPDFSAHPY 721 >ref|XP_010048696.1| PREDICTED: cyclic nucleotide-gated ion channel 17 isoform X1 [Eucalyptus grandis] Length = 723 Score = 73.6 bits (179), Expect = 6e-11 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADPY 717 NLGVTILAS+FAA+TR+GAQK K + MPKLQKPE+PDFS++PY Sbjct: 679 NLGVTILASRFAANTRRGAQKIKDVEMPKLQKPEEPDFSSEPY 721 >ref|XP_011082041.1| probable cyclic nucleotide-gated ion channel 14 [Sesamum indicum] Length = 722 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADP 720 NLGVTILAS+FAA+TR+GAQK K + +PKLQKPE+PDFSADP Sbjct: 678 NLGVTILASRFAANTRRGAQKIKNVELPKLQKPEEPDFSADP 719 >ref|XP_016484430.1| PREDICTED: probable cyclic nucleotide-gated ion channel 14 [Nicotiana tabacum] Length = 732 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADP 720 NLGVTILAS+FAA+TR+GAQK K M++PKLQKPE+PDFSA+P Sbjct: 688 NLGVTILASRFAANTRRGAQKMKDMDLPKLQKPEEPDFSAEP 729 >ref|XP_009593887.1| PREDICTED: probable cyclic nucleotide-gated ion channel 14 [Nicotiana tomentosiformis] Length = 732 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADP 720 NLGVTILAS+FAA+TR+GAQK K M++PKLQKPE+PDFSA+P Sbjct: 688 NLGVTILASRFAANTRRGAQKMKDMDLPKLQKPEEPDFSAEP 729 >ref|XP_016464534.1| PREDICTED: probable cyclic nucleotide-gated ion channel 14 [Nicotiana tabacum] Length = 734 Score = 72.8 bits (177), Expect = 1e-10 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADP 720 NLGVTILAS+FAA+TR+GAQK K M++PKLQKPE+PDFSA+P Sbjct: 690 NLGVTILASRFAANTRRGAQKMKDMDLPKLQKPEEPDFSAEP 731 >ref|XP_024033411.1| cyclic nucleotide-gated ion channel 17 isoform X2 [Citrus clementina] Length = 714 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADP 720 NLGVTILAS+FAA+TR+GAQK K ++MPKL+KPE+PDFSADP Sbjct: 670 NLGVTILASRFAANTRRGAQKLKDVDMPKLRKPEEPDFSADP 711 >ref|XP_006453463.1| cyclic nucleotide-gated ion channel 17 isoform X1 [Citrus clementina] ref|XP_006474120.1| PREDICTED: probable cyclic nucleotide-gated ion channel 17 [Citrus sinensis] gb|ESR66703.1| hypothetical protein CICLE_v10007594mg [Citrus clementina] Length = 722 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADP 720 NLGVTILAS+FAA+TR+GAQK K ++MPKL+KPE+PDFSADP Sbjct: 678 NLGVTILASRFAANTRRGAQKLKDVDMPKLRKPEEPDFSADP 719 >dbj|GAY48452.1| hypothetical protein CUMW_111750 [Citrus unshiu] Length = 724 Score = 72.4 bits (176), Expect = 2e-10 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADP 720 NLGVTILAS+FAA+TR+GAQK K ++MPKL+KPE+PDFSADP Sbjct: 680 NLGVTILASRFAANTRRGAQKLKDVDMPKLRKPEEPDFSADP 721 >gb|KDO62388.1| hypothetical protein CISIN_1g004506mg [Citrus sinensis] Length = 748 Score = 72.4 bits (176), Expect = 2e-10 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADP 720 NLGVTILAS+FAA+TR+GAQK K ++MPKL+KPE+PDFSADP Sbjct: 704 NLGVTILASRFAANTRRGAQKLKDVDMPKLRKPEEPDFSADP 745 >ref|XP_020080387.1| cyclic nucleotide-gated ion channel 17-like [Ananas comosus] Length = 716 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADPY 717 NL V+ILAS+FAASTRKG+QK K M++PKLQKP++PDFSA+PY Sbjct: 673 NLAVSILASRFAASTRKGSQKVKDMDLPKLQKPDEPDFSAEPY 715 >gb|OAY78401.1| putative cyclic nucleotide-gated ion channel 14 [Ananas comosus] Length = 716 Score = 72.0 bits (175), Expect = 2e-10 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -2 Query: 845 NLGVTILASKFAASTRKGAQKAKGMNMPKLQKPEDPDFSADPY 717 NL V+ILAS+FAASTRKG+QK K M++PKLQKP++PDFSA+PY Sbjct: 673 NLAVSILASRFAASTRKGSQKVKDMDLPKLQKPDEPDFSAEPY 715