BLASTX nr result
ID: Cheilocostus21_contig00029156
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00029156 (681 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009394514.1| PREDICTED: farnesyl pyrophosphate synthase 1... 60 4e-07 ref|XP_020106186.1| farnesyl pyrophosphate synthase-like isoform... 59 6e-07 gb|ONK78037.1| uncharacterized protein A4U43_C02F13540 [Asparagu... 59 9e-07 ref|XP_020106184.1| farnesyl pyrophosphate synthase 1-like isofo... 59 1e-06 ref|XP_020273463.1| farnesyl pyrophosphate synthase 1-like [Aspa... 59 1e-06 ref|XP_020253687.1| farnesyl pyrophosphate synthase 1-like [Aspa... 59 1e-06 ref|XP_010922976.1| PREDICTED: farnesyl pyrophosphate synthase [... 59 1e-06 ref|XP_017698872.1| PREDICTED: farnesyl pyrophosphate synthase 1... 58 3e-06 ref|XP_008792798.1| PREDICTED: farnesyl pyrophosphate synthase 1... 58 3e-06 gb|AHA51120.1| farnesyl pyrophosphate synthase [Ornithogalum lon... 58 3e-06 ref|XP_020594132.1| farnesyl pyrophosphate synthase 1-like isofo... 57 4e-06 ref|XP_020594131.1| farnesyl pyrophosphate synthase 1-like isofo... 57 5e-06 ref|XP_010924112.1| PREDICTED: farnesyl pyrophosphate synthase-l... 57 6e-06 ref|XP_010924109.1| PREDICTED: farnesyl pyrophosphate synthase 1... 57 6e-06 gb|ASO66850.1| farnesyl pyrophosphate synthase [Fritillaria unib... 57 9e-06 >ref|XP_009394514.1| PREDICTED: farnesyl pyrophosphate synthase 1 [Musa acuminata subsp. malaccensis] Length = 356 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SYE+L S+IE+LPSKAVQDVLKSFLHKIYKRQK Sbjct: 324 SYERLISAIEALPSKAVQDVLKSFLHKIYKRQK 356 >ref|XP_020106186.1| farnesyl pyrophosphate synthase-like isoform X3 [Ananas comosus] Length = 247 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SYE+L SSIE+ PSKAVQDVLKSFLHKIYKRQK Sbjct: 215 SYEKLISSIEAQPSKAVQDVLKSFLHKIYKRQK 247 >gb|ONK78037.1| uncharacterized protein A4U43_C02F13540 [Asparagus officinalis] Length = 305 Score = 59.3 bits (142), Expect = 9e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SYEQL SSIE+ PSKAVQ+VLKSFLHKIYKRQK Sbjct: 273 SYEQLISSIEAQPSKAVQEVLKSFLHKIYKRQK 305 >ref|XP_020106184.1| farnesyl pyrophosphate synthase 1-like isoform X1 [Ananas comosus] ref|XP_020106185.1| farnesyl pyrophosphate synthase 1-like isoform X2 [Ananas comosus] gb|OAY72641.1| Farnesyl pyrophosphate synthase 1 [Ananas comosus] gb|OAY75762.1| Farnesyl pyrophosphate synthase 1 [Ananas comosus] Length = 345 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SYE+L SSIE+ PSKAVQDVLKSFLHKIYKRQK Sbjct: 313 SYEKLISSIEAQPSKAVQDVLKSFLHKIYKRQK 345 >ref|XP_020273463.1| farnesyl pyrophosphate synthase 1-like [Asparagus officinalis] Length = 349 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SYEQL SSIE+ PSKAVQ+VLKSFLHKIYKRQK Sbjct: 317 SYEQLISSIEAQPSKAVQEVLKSFLHKIYKRQK 349 >ref|XP_020253687.1| farnesyl pyrophosphate synthase 1-like [Asparagus officinalis] Length = 375 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SYEQL SSIE+ PSKAVQ+VLKSFLHKIYKRQK Sbjct: 343 SYEQLISSIEAQPSKAVQEVLKSFLHKIYKRQK 375 >ref|XP_010922976.1| PREDICTED: farnesyl pyrophosphate synthase [Elaeis guineensis] Length = 350 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SYEQL SSIE+ PSK VQDVLKSFLHKIYKRQK Sbjct: 318 SYEQLISSIEAQPSKQVQDVLKSFLHKIYKRQK 350 >ref|XP_017698872.1| PREDICTED: farnesyl pyrophosphate synthase 1-like isoform X2 [Phoenix dactylifera] Length = 341 Score = 58.2 bits (139), Expect = 3e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SY QL SSIE LPSKAVQ+VLKSFLHKIYKRQK Sbjct: 309 SYLQLISSIEGLPSKAVQEVLKSFLHKIYKRQK 341 >ref|XP_008792798.1| PREDICTED: farnesyl pyrophosphate synthase 1-like isoform X1 [Phoenix dactylifera] Length = 350 Score = 58.2 bits (139), Expect = 3e-06 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SY QL SSIE LPSKAVQ+VLKSFLHKIYKRQK Sbjct: 318 SYLQLISSIEGLPSKAVQEVLKSFLHKIYKRQK 350 >gb|AHA51120.1| farnesyl pyrophosphate synthase [Ornithogalum longebracteatum] Length = 347 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SY+QL SSIE+ PSKAVQ+VLKSFLHKIYKRQK Sbjct: 315 SYKQLISSIEAQPSKAVQEVLKSFLHKIYKRQK 347 >ref|XP_020594132.1| farnesyl pyrophosphate synthase 1-like isoform X2 [Phalaenopsis equestris] Length = 309 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SYEQL SSIE+ PSK VQ+VLKSFLHKIYKRQK Sbjct: 277 SYEQLISSIEAQPSKQVQEVLKSFLHKIYKRQK 309 >ref|XP_020594131.1| farnesyl pyrophosphate synthase 1-like isoform X1 [Phalaenopsis equestris] Length = 348 Score = 57.4 bits (137), Expect = 5e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SYEQL SSIE+ PSK VQ+VLKSFLHKIYKRQK Sbjct: 316 SYEQLISSIEAQPSKQVQEVLKSFLHKIYKRQK 348 >ref|XP_010924112.1| PREDICTED: farnesyl pyrophosphate synthase-like isoform X2 [Elaeis guineensis] Length = 318 Score = 57.0 bits (136), Expect = 6e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SYEQL SSIE LP +AVQ+VLKSFLHKIYKR+K Sbjct: 286 SYEQLISSIEGLPGRAVQEVLKSFLHKIYKRRK 318 >ref|XP_010924109.1| PREDICTED: farnesyl pyrophosphate synthase 1-like isoform X1 [Elaeis guineensis] Length = 350 Score = 57.0 bits (136), Expect = 6e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SYEQL SSIE LP +AVQ+VLKSFLHKIYKR+K Sbjct: 318 SYEQLISSIEGLPGRAVQEVLKSFLHKIYKRRK 350 >gb|ASO66850.1| farnesyl pyrophosphate synthase [Fritillaria unibracteata] Length = 352 Score = 56.6 bits (135), Expect = 9e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 680 SYEQLTSSIESLPSKAVQDVLKSFLHKIYKRQK 582 SY QL SSIE+ PSKAVQ+VLKSFLHKIYKRQK Sbjct: 320 SYVQLISSIEAQPSKAVQEVLKSFLHKIYKRQK 352