BLASTX nr result
ID: Cheilocostus21_contig00029153
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00029153 (614 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONI06106.1| hypothetical protein PRUPE_5G040800 [Prunus persica] 107 3e-26 ref|XP_018853959.1| PREDICTED: probable protein phosphatase 2C 2... 104 3e-25 gb|EYU17848.1| hypothetical protein MIMGU_mgv1a0231131mg, partia... 105 4e-25 gb|KHN42615.1| Protein phosphatase 2C 29 [Glycine soja] 104 1e-24 ref|XP_006385628.1| hypothetical protein POPTR_0003s08790g [Popu... 103 2e-24 ref|XP_009785866.1| PREDICTED: probable protein phosphatase 2C 2... 102 2e-24 ref|XP_020575219.1| probable protein phosphatase 2C 26 [Phalaeno... 108 6e-24 ref|XP_020672504.1| probable protein phosphatase 2C 26 [Dendrobi... 108 6e-24 gb|PKI57157.1| hypothetical protein CRG98_022447 [Punica granatum] 102 6e-24 gb|PKA53964.1| putative protein phosphatase 2C 26 [Apostasia she... 108 1e-23 ref|XP_022757557.1| protein phosphatase 2C 29-like isoform X1 [D... 107 2e-23 ref|XP_021828344.1| protein phosphatase 2C 29 [Prunus avium] 107 3e-23 ref|XP_020419165.1| protein phosphatase 2C 29 [Prunus persica] 107 3e-23 ref|XP_008238289.1| PREDICTED: protein phosphatase 2C 29 [Prunus... 107 3e-23 ref|XP_008373546.1| PREDICTED: protein phosphatase 2C 29 [Malus ... 107 3e-23 ref|XP_024175103.1| protein phosphatase 2C 29 [Rosa chinensis] >... 107 3e-23 ref|XP_021298202.1| protein phosphatase 2C 29 isoform X1 [Herran... 107 3e-23 ref|XP_007039547.2| PREDICTED: protein phosphatase 2C 29 [Theobr... 107 3e-23 gb|EOY24048.1| Poltergeist like 1 isoform 1 [Theobroma cacao] 107 3e-23 ref|XP_011465169.1| PREDICTED: protein phosphatase 2C 29 [Fragar... 107 3e-23 >gb|ONI06106.1| hypothetical protein PRUPE_5G040800 [Prunus persica] Length = 120 Score = 107 bits (266), Expect = 3e-26 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 63 PAQHLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 118 >ref|XP_018853959.1| PREDICTED: probable protein phosphatase 2C 26 [Juglans regia] Length = 120 Score = 104 bits (259), Expect = 3e-25 Identities = 46/56 (82%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ L+EE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVM++SLEGRIW++SGK Sbjct: 63 PAQHLLEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMIVSLEGRIWKTSGK 118 >gb|EYU17848.1| hypothetical protein MIMGU_mgv1a0231131mg, partial [Erythranthe guttata] Length = 167 Score = 105 bits (262), Expect = 4e-25 Identities = 48/56 (85%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+LFRAA++AG+DFHELLDIPQGDRR+YHDDVTVMV+SLEGRIW+SSGK Sbjct: 110 PAQHLIEELLFRAARKAGMDFHELLDIPQGDRRKYHDDVTVMVVSLEGRIWKSSGK 165 >gb|KHN42615.1| Protein phosphatase 2C 29 [Glycine soja] Length = 170 Score = 104 bits (259), Expect = 1e-24 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+L RAAK+AG+DFHELLDIPQGDRR+YHDDVTVMV+SLEGRIW+SSGK Sbjct: 113 PAQHLIEELLLRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVVSLEGRIWKSSGK 168 >ref|XP_006385628.1| hypothetical protein POPTR_0003s08790g [Populus trichocarpa] Length = 169 Score = 103 bits (258), Expect = 2e-24 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+L RAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 112 PAQHLIEELLSRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 167 >ref|XP_009785866.1| PREDICTED: probable protein phosphatase 2C 26 [Nicotiana sylvestris] Length = 133 Score = 102 bits (254), Expect = 2e-24 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LI E+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLE RIW+SSGK Sbjct: 76 PAQHLIAELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEARIWKSSGK 131 >ref|XP_020575219.1| probable protein phosphatase 2C 26 [Phalaenopsis equestris] Length = 606 Score = 108 bits (271), Expect = 6e-24 Identities = 51/56 (91%), Positives = 56/56 (100%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQSLIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 549 PAQSLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 604 >ref|XP_020672504.1| probable protein phosphatase 2C 26 [Dendrobium catenatum] Length = 613 Score = 108 bits (271), Expect = 6e-24 Identities = 51/56 (91%), Positives = 56/56 (100%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQSLIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 556 PAQSLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 611 >gb|PKI57157.1| hypothetical protein CRG98_022447 [Punica granatum] Length = 169 Score = 102 bits (254), Expect = 6e-24 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+L RAAK+AG++FHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 112 PAQHLIEELLSRAAKKAGMEFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 167 >gb|PKA53964.1| putative protein phosphatase 2C 26 [Apostasia shenzhenica] Length = 642 Score = 108 bits (269), Expect = 1e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQSL+EE+LFRAAK AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 585 PAQSLVEELLFRAAKRAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 640 >ref|XP_022757557.1| protein phosphatase 2C 29-like isoform X1 [Durio zibethinus] Length = 791 Score = 107 bits (268), Expect = 2e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEEVLFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMV+SLEGRIW+SSGK Sbjct: 734 PAQQLIEEVLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVLSLEGRIWKSSGK 789 >ref|XP_021828344.1| protein phosphatase 2C 29 [Prunus avium] Length = 777 Score = 107 bits (266), Expect = 3e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 720 PAQHLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 775 >ref|XP_020419165.1| protein phosphatase 2C 29 [Prunus persica] Length = 777 Score = 107 bits (266), Expect = 3e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 720 PAQHLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 775 >ref|XP_008238289.1| PREDICTED: protein phosphatase 2C 29 [Prunus mume] Length = 777 Score = 107 bits (266), Expect = 3e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 720 PAQHLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 775 >ref|XP_008373546.1| PREDICTED: protein phosphatase 2C 29 [Malus domestica] ref|XP_008373547.1| PREDICTED: protein phosphatase 2C 29 [Malus domestica] ref|XP_008373548.1| PREDICTED: protein phosphatase 2C 29 [Malus domestica] ref|XP_008373549.1| PREDICTED: protein phosphatase 2C 29 [Malus domestica] Length = 780 Score = 107 bits (266), Expect = 3e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 723 PAQHLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 778 >ref|XP_024175103.1| protein phosphatase 2C 29 [Rosa chinensis] gb|PRQ18714.1| putative protein-serine/threonine phosphatase [Rosa chinensis] Length = 784 Score = 107 bits (266), Expect = 3e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 727 PAQHLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 782 >ref|XP_021298202.1| protein phosphatase 2C 29 isoform X1 [Herrania umbratica] Length = 786 Score = 107 bits (266), Expect = 3e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 729 PAQHLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 784 >ref|XP_007039547.2| PREDICTED: protein phosphatase 2C 29 [Theobroma cacao] Length = 786 Score = 107 bits (266), Expect = 3e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 729 PAQHLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 784 >gb|EOY24048.1| Poltergeist like 1 isoform 1 [Theobroma cacao] Length = 786 Score = 107 bits (266), Expect = 3e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 729 PAQHLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 784 >ref|XP_011465169.1| PREDICTED: protein phosphatase 2C 29 [Fragaria vesca subsp. vesca] Length = 787 Score = 107 bits (266), Expect = 3e-23 Identities = 50/56 (89%), Positives = 55/56 (98%) Frame = +3 Query: 3 PAQSLIEEVLFRAAKEAGLDFHELLDIPQGDRRRYHDDVTVMVISLEGRIWQSSGK 170 PAQ LIEE+LFRAAK+AG+DFHELLDIPQGDRR+YHDDVTVMVISLEGRIW+SSGK Sbjct: 730 PAQHLIEELLFRAAKKAGMDFHELLDIPQGDRRKYHDDVTVMVISLEGRIWKSSGK 785