BLASTX nr result
ID: Cheilocostus21_contig00028863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00028863 (606 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009404462.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 68 7e-10 >ref|XP_009404462.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 38-like [Musa acuminata subsp. malaccensis] Length = 499 Score = 68.2 bits (165), Expect = 7e-10 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 359 AQATDEVRTSEHNKIESLSISDGKDGGDQEPGDAYDADSNSGGRLLDDPDNADIKA 192 +QA DE + SE KIESLSISD KDGGD+ P DS+ GGRLLDDPD++DIKA Sbjct: 33 SQAADEAQPSELKKIESLSISDVKDGGDRAP-----EDSDGGGRLLDDPDDSDIKA 83