BLASTX nr result
ID: Cheilocostus21_contig00028854
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00028854 (608 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009414284.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxi... 57 5e-06 >ref|XP_009414284.1| PREDICTED: acyl-coenzyme A oxidase 4, peroxisomal [Musa acuminata subsp. malaccensis] Length = 436 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +1 Query: 475 AAGGGDDHSNYCTNSHPG-SRLDISVAFPQATPASIFPPSSSDYY 606 A+ DDH SH G L+ISVAFPQATPAS+FPPSSSDYY Sbjct: 2 ASSNQDDHHMASMGSHSGLPPLNISVAFPQATPASVFPPSSSDYY 46