BLASTX nr result
ID: Cheilocostus21_contig00028797
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00028797 (558 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD13304.1| polyprotein [Solanum lycopersicum] 39 1e-07 >gb|AAD13304.1| polyprotein [Solanum lycopersicum] Length = 1542 Score = 39.3 bits (90), Expect(3) = 1e-07 Identities = 20/42 (47%), Positives = 30/42 (71%), Gaps = 2/42 (4%) Frame = +3 Query: 390 CSS--SAKLFYNNVVEYLGLLANIISDYDSCFIEYF*ISLFN 509 CSS +A+LFY +V++Y G+ A+I+SD D+ F F +LFN Sbjct: 1203 CSSEVAAELFYKHVIKYFGVPADIVSDRDTRFTGRFWTALFN 1244 Score = 33.9 bits (76), Expect(3) = 1e-07 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 229 EKGGGFVATLPILKKPWM*FSYT-IGGMPMVDRQSSIFVVINQ 354 +K G + LPI ++PW+ S I G P VD ++SI VV+++ Sbjct: 1147 KKEAGLLQPLPIPERPWLSVSMDFISGFPKVDGKASIMVVVDR 1189 Score = 29.6 bits (65), Expect(3) = 1e-07 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 161 KMELDKNIYMRTRLVYYQDKTKRRKEVVLLLP 256 KME D Y++T V DKT+R+KE LL P Sbjct: 1124 KMEDDIEAYVKTCHVCQVDKTERKKEAGLLQP 1155