BLASTX nr result
ID: Cheilocostus21_contig00028650
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00028650 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009382991.1| PREDICTED: microtubule-associated protein 70... 86 1e-16 ref|XP_009380076.1| PREDICTED: microtubule-associated protein 70... 72 8e-12 ref|XP_008781372.1| PREDICTED: microtubule-associated protein 70... 70 4e-11 ref|XP_009390353.1| PREDICTED: microtubule-associated protein 70... 70 5e-11 ref|XP_010926101.1| PREDICTED: microtubule-associated protein 70... 67 6e-10 ref|XP_010916224.1| PREDICTED: microtubule-associated protein 70... 66 8e-10 ref|XP_010916223.1| PREDICTED: microtubule-associated protein 70... 66 8e-10 ref|XP_008775595.1| PREDICTED: microtubule-associated protein 70... 66 8e-10 ref|XP_009404137.1| PREDICTED: microtubule-associated protein 70... 64 7e-09 ref|XP_010932544.1| PREDICTED: microtubule-associated protein 70... 60 1e-07 ref|XP_010932543.1| PREDICTED: microtubule-associated protein 70... 60 1e-07 ref|XP_010932540.1| PREDICTED: microtubule-associated protein 70... 60 1e-07 ref|XP_020257187.1| microtubule-associated protein 70-2-like iso... 57 1e-06 ref|XP_020257186.1| microtubule-associated protein 70-2-like iso... 57 1e-06 ref|XP_008812973.1| PREDICTED: microtubule-associated protein 70... 57 1e-06 ref|XP_020095279.1| microtubule-associated protein 70-1-like [An... 57 2e-06 gb|PKA49980.1| Microtubule-associated protein 70-2 [Apostasia sh... 55 9e-06 >ref|XP_009382991.1| PREDICTED: microtubule-associated protein 70-1 [Musa acuminata subsp. malaccensis] Length = 617 Score = 85.9 bits (211), Expect = 1e-16 Identities = 43/69 (62%), Positives = 50/69 (72%) Frame = -1 Query: 209 MSDLYEDGSEGLSEETDGXXXXXXXXXXXASFKGEGKPAPALRRRAPMKPNLDIEEFMNL 30 MSDL++DG EG + E ASFKGEGK APALRRRA MKPN+++EEF+NL Sbjct: 1 MSDLFDDGGEGFACEATWGNATPAVVMASASFKGEGKAAPALRRRASMKPNVEVEEFINL 60 Query: 29 LHGSDPVRV 3 LHGSDPVRV Sbjct: 61 LHGSDPVRV 69 >ref|XP_009380076.1| PREDICTED: microtubule-associated protein 70-1 [Musa acuminata subsp. malaccensis] Length = 621 Score = 72.0 bits (175), Expect = 8e-12 Identities = 40/73 (54%), Positives = 46/73 (63%), Gaps = 4/73 (5%) Frame = -1 Query: 209 MSDLYEDGSEGLSEETDGXXXXXXXXXXXA----SFKGEGKPAPALRRRAPMKPNLDIEE 42 MSDL + G EG E G SFK EGK APALRRRA MKPNL+++E Sbjct: 1 MSDLRDFGGEGFLGEAAGGNATPQPAPEALTASASFKIEGKSAPALRRRASMKPNLEVDE 60 Query: 41 FMNLLHGSDPVRV 3 F+NLLHGSDPV+V Sbjct: 61 FINLLHGSDPVKV 73 >ref|XP_008781372.1| PREDICTED: microtubule-associated protein 70-1-like [Phoenix dactylifera] Length = 625 Score = 70.1 bits (170), Expect = 4e-11 Identities = 38/72 (52%), Positives = 43/72 (59%), Gaps = 3/72 (4%) Frame = -1 Query: 209 MSDLYEDGSEGLSEETDGXXXXXXXXXXXA---SFKGEGKPAPALRRRAPMKPNLDIEEF 39 M+DL G EG ET G SFKGEGK PALRRR +KP L+ EEF Sbjct: 2 MADLSSGGGEGHGAETGGGNAPMAAPVVLTASASFKGEGKAGPALRRRPSIKPTLEAEEF 61 Query: 38 MNLLHGSDPVRV 3 +N+LHGSDPVRV Sbjct: 62 INMLHGSDPVRV 73 >ref|XP_009390353.1| PREDICTED: microtubule-associated protein 70-1 [Musa acuminata subsp. malaccensis] Length = 621 Score = 69.7 bits (169), Expect = 5e-11 Identities = 37/73 (50%), Positives = 45/73 (61%), Gaps = 4/73 (5%) Frame = -1 Query: 209 MSDLYEDGSEGLSEETDGXXXXXXXXXXXA----SFKGEGKPAPALRRRAPMKPNLDIEE 42 MSDL++D EG E DG S +GE K P LRRRA +KP+LD+EE Sbjct: 1 MSDLFDDCGEGFVGEADGGNATPTTQPAVLTASVSSRGEPKAGPTLRRRASIKPSLDVEE 60 Query: 41 FMNLLHGSDPVRV 3 F+NLLHGSDPV+V Sbjct: 61 FINLLHGSDPVKV 73 >ref|XP_010926101.1| PREDICTED: microtubule-associated protein 70-1-like [Elaeis guineensis] Length = 626 Score = 66.6 bits (161), Expect = 6e-10 Identities = 37/74 (50%), Positives = 43/74 (58%), Gaps = 5/74 (6%) Frame = -1 Query: 209 MSDLYEDGSEGLSEETDGXXXXXXXXXXXA-----SFKGEGKPAPALRRRAPMKPNLDIE 45 M+DL G EG E G SFKGEGK PALRRR +KP+L+ E Sbjct: 1 MADLSGGGGEGHGAEAGGGNAPPPSAAPAVLTASASFKGEGKVGPALRRRPSIKPSLEAE 60 Query: 44 EFMNLLHGSDPVRV 3 EF+N+LHGSDPVRV Sbjct: 61 EFINMLHGSDPVRV 74 >ref|XP_010916224.1| PREDICTED: microtubule-associated protein 70-1 isoform X2 [Elaeis guineensis] Length = 621 Score = 66.2 bits (160), Expect = 8e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 119 SFKGEGKPAPALRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 SFKGEGK PALRRR +KP+L++EEF+N+LHGSDPVRV Sbjct: 36 SFKGEGKAGPALRRRPSIKPSLEVEEFINMLHGSDPVRV 74 >ref|XP_010916223.1| PREDICTED: microtubule-associated protein 70-1 isoform X1 [Elaeis guineensis] Length = 626 Score = 66.2 bits (160), Expect = 8e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 119 SFKGEGKPAPALRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 SFKGEGK PALRRR +KP+L++EEF+N+LHGSDPVRV Sbjct: 36 SFKGEGKAGPALRRRPSIKPSLEVEEFINMLHGSDPVRV 74 >ref|XP_008775595.1| PREDICTED: microtubule-associated protein 70-1-like [Phoenix dactylifera] Length = 628 Score = 66.2 bits (160), Expect = 8e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 119 SFKGEGKPAPALRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 SFKGEGK PALRRR +KP+L++EEF+N+LHGSDPVRV Sbjct: 38 SFKGEGKAGPALRRRPSIKPSLEVEEFINMLHGSDPVRV 76 >ref|XP_009404137.1| PREDICTED: microtubule-associated protein 70-1 isoform X1 [Musa acuminata subsp. malaccensis] Length = 621 Score = 63.5 bits (153), Expect = 7e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 119 SFKGEGKPAPALRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 SFK EG+ A ALRRRA MKPNL+ EEF+N+LHGSDPVRV Sbjct: 35 SFKIEGRAASALRRRASMKPNLEAEEFINMLHGSDPVRV 73 >ref|XP_010932544.1| PREDICTED: microtubule-associated protein 70-2-like isoform X3 [Elaeis guineensis] Length = 611 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 119 SFKGEGKPAPALRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 SFKGEG+ A A RRRAP++ +LD EEF+NLLHGSDPV+V Sbjct: 29 SFKGEGRLAGAPRRRAPIRASLDAEEFINLLHGSDPVKV 67 >ref|XP_010932543.1| PREDICTED: microtubule-associated protein 70-2-like isoform X2 [Elaeis guineensis] Length = 620 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 119 SFKGEGKPAPALRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 SFKGEG+ A A RRRAP++ +LD EEF+NLLHGSDPV+V Sbjct: 29 SFKGEGRLAGAPRRRAPIRASLDAEEFINLLHGSDPVKV 67 >ref|XP_010932540.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 [Elaeis guineensis] ref|XP_010932541.1| PREDICTED: microtubule-associated protein 70-2-like isoform X1 [Elaeis guineensis] Length = 644 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -1 Query: 119 SFKGEGKPAPALRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 SFKGEG+ A A RRRAP++ +LD EEF+NLLHGSDPV+V Sbjct: 29 SFKGEGRLAGAPRRRAPIRASLDAEEFINLLHGSDPVKV 67 >ref|XP_020257187.1| microtubule-associated protein 70-2-like isoform X2 [Asparagus officinalis] gb|ONK75332.1| uncharacterized protein A4U43_C03F15740 [Asparagus officinalis] Length = 607 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 119 SFKGEGKPAPALRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 SFKGEGK + L+RR +KP+ + EEF+NLLHGSDPVRV Sbjct: 21 SFKGEGKSSAMLKRRPSVKPSSETEEFINLLHGSDPVRV 59 >ref|XP_020257186.1| microtubule-associated protein 70-2-like isoform X1 [Asparagus officinalis] Length = 633 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 119 SFKGEGKPAPALRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 SFKGEGK + L+RR +KP+ + EEF+NLLHGSDPVRV Sbjct: 21 SFKGEGKSSAMLKRRPSVKPSSETEEFINLLHGSDPVRV 59 >ref|XP_008812973.1| PREDICTED: microtubule-associated protein 70-2-like [Phoenix dactylifera] Length = 620 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -1 Query: 119 SFKGEGKPAPALRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 +FKGE + A A RRRAP++ +LD EEF+NLLHGSDPVRV Sbjct: 29 TFKGEIRSAGAPRRRAPIRASLDAEEFINLLHGSDPVRV 67 >ref|XP_020095279.1| microtubule-associated protein 70-1-like [Ananas comosus] Length = 626 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 5/44 (11%) Frame = -1 Query: 119 SFKGEGKPAPA-----LRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 + KGEGK APA L+RR +KP+L+++EF+NLLHGSDPVRV Sbjct: 37 ALKGEGKSAPAPAAVALKRRPSIKPSLEVDEFINLLHGSDPVRV 80 >gb|PKA49980.1| Microtubule-associated protein 70-2 [Apostasia shenzhenica] Length = 635 Score = 54.7 bits (130), Expect = 9e-06 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = -1 Query: 119 SFKGEGKPAPALRRRAPMKPNLDIEEFMNLLHGSDPVRV 3 SFKG+G+ + RRR +KP++D EEF+NLLHGSDPV+V Sbjct: 44 SFKGDGRSSGKERRRPAVKPSVDAEEFINLLHGSDPVKV 82